| Clone Name | bags31i02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CH60_PYRSA (P46224) 60 kDa chaperonin (Protein Cpn60) (groEL pro... | 30 | 3.7 | 2 | POM1_SCHPO (Q09690) Dual specificity protein kinase pom1 (EC 2.7... | 29 | 6.3 | 3 | F113A_MOUSE (Q6P1Z5) Protein FAM113A | 29 | 8.2 |
|---|
>CH60_PYRSA (P46224) 60 kDa chaperonin (Protein Cpn60) (groEL protein)| Length = 585 Score = 30.0 bits (66), Expect = 3.7 Identities = 29/135 (21%), Positives = 57/135 (42%), Gaps = 19/135 (14%) Frame = +1 Query: 133 GGLKGKVTKLTSXRSMNGKSKERSLQSXRINLMAVEKXINAAIDRVCEFTGLK------- 291 G + G T + +N +++ L I + VEK ++A + R+ E TG+ Sbjct: 437 GIVPGGATLIHFIEDLNDWAEDNLLDDELIGALIVEKALSAPMKRIIENTGISSSIIIEK 496 Query: 292 ------VIFWDLQQPFIDNMYK------NNVSQARLDTIVEVLDLVLAQLCDVIVEQLRD 435 I ++ Q I++MY+ V+++ + + ++L C V+ D Sbjct: 497 IKDKDFSIGYNAAQGEIEDMYEIGVIDPAKVTRSAMQNAASIASMILTTECIVV-----D 551 Query: 436 RVVTGLLQASLDGLV 480 + T L+ S+ LV Sbjct: 552 KKKTCSLETSIYWLV 566
>POM1_SCHPO (Q09690) Dual specificity protein kinase pom1 (EC 2.7.12.1)| Length = 1087 Score = 29.3 bits (64), Expect = 6.3 Identities = 14/43 (32%), Positives = 25/43 (58%), Gaps = 1/43 (2%) Frame = -1 Query: 468 QGCLQKPCNHTISQLLHN-DVTELSKHQIKNFDNSVQSSLRNI 343 + C+ P +T QL++ +TE + +I N+DN + LRN+ Sbjct: 622 RACIITPVRNTEVQLINTAPLTEYEQDEINNYDNIYFTGLRNV 664
>F113A_MOUSE (Q6P1Z5) Protein FAM113A| Length = 449 Score = 28.9 bits (63), Expect = 8.2 Identities = 10/33 (30%), Positives = 19/33 (57%) Frame = -1 Query: 381 NFDNSVQSSLRNIVFVHIVDEWLLEVPKYDL*P 283 ++D L +++ H+ D W +E+PK+D P Sbjct: 248 HWDQHAHRHLSHLLLAHVADAWGVELPKHDRLP 280 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,541,404 Number of Sequences: 219361 Number of extensions: 1052482 Number of successful extensions: 3071 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3027 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3070 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)