| Clone Name | bags31e02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | RL28_DROME (Q9VZS5) 60S ribosomal protein L28 | 34 | 0.24 | 2 | RL28_DICDI (Q9GS21) 60S ribosomal protein L28 | 29 | 6.0 | 3 | MYB_HUMAN (P10242) Myb proto-oncogene protein (C-myb) | 29 | 7.8 | 4 | CORIN_HUMAN (Q9Y5Q5) Atrial natriuteric peptide-converting enzym... | 29 | 7.8 |
|---|
>RL28_DROME (Q9VZS5) 60S ribosomal protein L28| Length = 144 Score = 33.9 bits (76), Expect = 0.24 Identities = 20/44 (45%), Positives = 26/44 (59%) Frame = +2 Query: 239 RKMAKAVKNQVSDNYYRPDLTKPALARLSAVYRSLQVAKSGVKK 370 R+ K +KN + + YR DLT+ AL R SAV RS + A KK Sbjct: 91 RRSLKKLKNLLIGSKYRKDLTQAALRRASAVLRSQKPAPVKGKK 134 Score = 28.9 bits (63), Expect = 7.8 Identities = 11/18 (61%), Positives = 15/18 (83%) Frame = +3 Query: 60 PNNLYNVHSYKYSGLANK 113 PNNL +V SY+YSG+ +K Sbjct: 33 PNNLASVSSYRYSGIVHK 50
>RL28_DICDI (Q9GS21) 60S ribosomal protein L28| Length = 132 Score = 29.3 bits (64), Expect = 6.0 Identities = 14/25 (56%), Positives = 16/25 (64%) Frame = +3 Query: 60 PNNLYNVHSYKYSGLANKXDCDGAA 134 P NL N +S KYSGLA + D AA Sbjct: 29 PGNLRNKNSLKYSGLARRTTIDVAA 53
>MYB_HUMAN (P10242) Myb proto-oncogene protein (C-myb)| Length = 640 Score = 28.9 bits (63), Expect = 7.8 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 1/46 (2%) Frame = -3 Query: 422 THPQNK-LTSPSVLTACSSS*HQTWQPGGCGKLRSVLQEQAWSSQA 288 T P+N+ L SP L CSS TW+P CGK+ ++ SSQA Sbjct: 590 TVPKNRSLASP--LQPCSS----TWEPASCGKME---EQMTSSSQA 626
>CORIN_HUMAN (Q9Y5Q5) Atrial natriuteric peptide-converting enzyme (EC 3.4.21.-)| (pro-ANP-converting enzyme) (Corin) (Heart-specific serine proteinase ATC2) (Transmembrane protease, serine 10) Length = 1042 Score = 28.9 bits (63), Expect = 7.8 Identities = 15/43 (34%), Positives = 20/43 (46%), Gaps = 3/43 (6%) Frame = +3 Query: 120 CDGAACC*EGDD---CGPLHNQVKEAEQACGLHPQXLSCARSS 239 CDG C +G D C + +E +Q C +P SC SS Sbjct: 399 CDGDEDCKDGSDEENCSVIQTSCQEGDQRCLYNPCLDSCGGSS 441 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.315 0.128 0.407 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 51,261,137 Number of Sequences: 219361 Number of extensions: 826111 Number of successful extensions: 2031 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1948 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2031 length of database: 80,573,946 effective HSP length: 103 effective length of database: 57,979,763 effective search space used: 3478785780 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits)