| Clone Name | bags31c17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PIT1_SCHPO (O14132) Sporulation protein kinase pit1 (EC 2.7.11.1) | 30 | 2.7 | 2 | KTR2_YEAST (P33550) Probable mannosyltransferase KTR2 (EC 2.4.1.... | 29 | 6.1 | 3 | VP91_NPVEP (Q91GH8) Capsid-associated protein Vp91 precursor | 29 | 6.1 | 4 | 5NTD_BOVIN (Q05927) 5'-nucleotidase precursor (EC 3.1.3.5) (Ecto... | 29 | 7.9 |
|---|
>PIT1_SCHPO (O14132) Sporulation protein kinase pit1 (EC 2.7.11.1)| Length = 650 Score = 30.4 bits (67), Expect = 2.7 Identities = 17/51 (33%), Positives = 24/51 (47%) Frame = +1 Query: 28 ESCQSIGDASGGSFSSSELNGQPLNDALLDMESSSFGFLSQIPRNFSFSDL 180 E Q+ GD GG + +EL L +L M FG L P N +F+ + Sbjct: 262 EQSQNTGDKGGGIWDRAELLANKLGISLPKMAPLDFGDLFSPPWNLAFASM 312
>KTR2_YEAST (P33550) Probable mannosyltransferase KTR2 (EC 2.4.1.131)| Length = 425 Score = 29.3 bits (64), Expect = 6.1 Identities = 25/70 (35%), Positives = 36/70 (51%), Gaps = 9/70 (12%) Frame = +1 Query: 112 LDMESSSFGFLSQ---IPRNFSFSDLTEGFN-----QNTEVLD-NYSRSPFLSSEPNNFS 264 +DMES++FGF+S I ++F D G+N N E+ D N+ RS + Sbjct: 274 IDMESNAFGFVSNFDFIGKSFGVIDSNSGYNLCHFWTNFEIGDLNFFRSE-KYIRFFEYL 332 Query: 265 DSTGGEHTER 294 DS GG + ER Sbjct: 333 DSKGGFYYER 342
>VP91_NPVEP (Q91GH8) Capsid-associated protein Vp91 precursor| Length = 826 Score = 29.3 bits (64), Expect = 6.1 Identities = 13/34 (38%), Positives = 19/34 (55%) Frame = +1 Query: 100 NDALLDMESSSFGFLSQIPRNFSFSDLTEGFNQN 201 ND +DM++S G IP+ + DL + F QN Sbjct: 423 NDYNIDMQTSIIGLTDMIPKLLAGDDLDDTFGQN 456
>5NTD_BOVIN (Q05927) 5'-nucleotidase precursor (EC 3.1.3.5)| (Ecto-5'-nucleotidase) (5'-NT) (CD73 antigen) Length = 574 Score = 28.9 bits (63), Expect = 7.9 Identities = 17/43 (39%), Positives = 19/43 (44%), Gaps = 8/43 (18%) Frame = +2 Query: 251 QITSQILQVENIQSVYDFCLN--------HVSCCACRLSSYPP 355 Q T + LQV I VYD N V C CR+ SY P Sbjct: 444 QRTGEFLQVGGIHVVYDISRNPGDRVVKLEVLCTQCRVPSYEP 486 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 77,394,798 Number of Sequences: 219361 Number of extensions: 1567329 Number of successful extensions: 4198 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4073 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4196 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3523384522 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)