| Clone Name | bags31b21 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MURD_RHOPA (Q6N409) UDP-N-acetylmuramoylalanine--D-glutamate lig... | 29 | 8.9 | 2 | EXEC1_ARATH (Q93YW0) EXECUTER1 protein, chloroplast precursor | 29 | 8.9 |
|---|
>MURD_RHOPA (Q6N409) UDP-N-acetylmuramoylalanine--D-glutamate ligase (EC| 6.3.2.9) (UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase) (D-glutamic acid-adding enzyme) Length = 469 Score = 29.3 bits (64), Expect = 8.9 Identities = 20/46 (43%), Positives = 25/46 (54%) Frame = -2 Query: 304 AFVISCWCK*SEMVA*ACRWYVVADSRNVPYT*TALLV*GLRVPLT 167 A VI+C MV A ++ AD RN+P+T A LV VPLT Sbjct: 33 AEVIACDDNLDRMVEAAQAGFITADLRNLPWTNFAALVLTPGVPLT 78
>EXEC1_ARATH (Q93YW0) EXECUTER1 protein, chloroplast precursor| Length = 684 Score = 29.3 bits (64), Expect = 8.9 Identities = 14/33 (42%), Positives = 18/33 (54%), Gaps = 2/33 (6%) Frame = -2 Query: 508 NPRWHSTV--VYFSACRRLCLLLPWFVLLSRDD 416 NPRW S + V SA +R +L W+ L DD Sbjct: 64 NPRWDSAIQDVLKSAIKRFDSVLSWYATLDNDD 96 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,763,808 Number of Sequences: 219361 Number of extensions: 1605688 Number of successful extensions: 4382 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 4255 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4380 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)