| Clone Name | bags30m09 |
|---|---|
| Clone Library Name | barley_pub |
>MURB_SALTY (P37417) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 342 Score = 29.3 bits (64), Expect = 3.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 189 RTCEASFCVRLESGWSVRASMPPCAFGLR 103 R C+ CV LE+G +R S C FG R Sbjct: 131 RVCDYVDCVELETGKRLRLSAAECRFGYR 159
>MURB_SALTI (Q8Z316) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 342 Score = 29.3 bits (64), Expect = 3.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 189 RTCEASFCVRLESGWSVRASMPPCAFGLR 103 R C+ CV LE+G +R S C FG R Sbjct: 131 RVCDYVDCVELETGKRLRLSAAECRFGYR 159
>MURB_SALCH (Q57H81) UDP-N-acetylenolpyruvoylglucosamine reductase (EC| 1.1.1.158) (UDP-N-acetylmuramate dehydrogenase) Length = 342 Score = 29.3 bits (64), Expect = 3.0 Identities = 13/29 (44%), Positives = 16/29 (55%) Frame = -2 Query: 189 RTCEASFCVRLESGWSVRASMPPCAFGLR 103 R C+ CV LE+G +R S C FG R Sbjct: 131 RVCDYVDCVELETGKRLRLSAAECRFGYR 159
>SYT2_AERPE (Q9YFY3) Probable threonyl-tRNA synthetase 2 (EC 6.1.1.3)| (Threonine--tRNA ligase 2) (ThrRS 2) Length = 406 Score = 28.1 bits (61), Expect = 6.7 Identities = 16/50 (32%), Positives = 22/50 (44%) Frame = +1 Query: 7 VKXLGLARRXXGPGWLDASFLNILGRRKRRCGAEAERARWHARTHTPATL 156 V+ GL RR G AS + ++G+R+ G R RW TL Sbjct: 334 VRGSGLGRRVREAGRSWASLVIVVGKREEETGTVVVRRRWEPGKQEVLTL 383
>RPGF3_HUMAN (O95398) Rap guanine nucleotide exchange factor 3 (cAMP-regulated| guanine nucleotide exchange factor I) (cAMP-GEFI) (Exchange factor directly activated by cAMP 1) (Epac 1) (Rap1 guanine-nucleotide-exchange factor directly activated by cAMP) Length = 881 Score = 27.7 bits (60), Expect = 8.7 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 8/47 (17%) Frame = +1 Query: 70 NILGRRKRRCGAEAERARWHARTHTPATLQP--------HTEARLAR 186 N++ K R A A R H R+H P L P H ++++AR Sbjct: 793 NLINFEKMRMMARAARMLHHCRSHNPVPLSPLRSRVSHLHEDSQVAR 839 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,921,132 Number of Sequences: 219361 Number of extensions: 271600 Number of successful extensions: 721 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 716 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 721 length of database: 80,573,946 effective HSP length: 38 effective length of database: 72,238,228 effective search space used: 1733717472 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)