| Clone Name | bags30m04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CS007_HUMAN (Q9UPT8) Zinc finger CCCH-type domain-containing pro... | 31 | 3.5 | 2 | CFTR_TRIVU (Q5D1Z7) Cystic fibrosis transmembrane conductance re... | 31 | 3.5 | 3 | CS007_MOUSE (Q6ZPZ3) Zinc finger CCCH-type domain-containing pro... | 31 | 3.5 | 4 | LKHA4_YEAST (Q10740) Probable leukotriene A-4 hydrolase (EC 3.3.... | 30 | 7.8 |
|---|
>CS007_HUMAN (Q9UPT8) Zinc finger CCCH-type domain-containing protein C19orf7| Length = 1303 Score = 30.8 bits (68), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 471 CVLHLHCNFSHFLQERRNKERCKFF 397 C HCNFSH ++ + +E CKF+ Sbjct: 404 CTWGDHCNFSHDIELPKKRELCKFY 428
>CFTR_TRIVU (Q5D1Z7) Cystic fibrosis transmembrane conductance regulator (CFTR)| (cAMP-dependent chloride channel) (ATP-binding cassette transporter sub-family C member 7) Length = 1478 Score = 30.8 bits (68), Expect = 3.5 Identities = 25/80 (31%), Positives = 35/80 (43%), Gaps = 1/80 (1%) Frame = +1 Query: 214 NLHVLVKQTTSSHKFWSSLGSCDHGAFLEGFELLGSRKAKN-TFLLCTASCSDIAGSGLD 390 +L + VKQ+ S K + + DHG F F LLG+ KN +F + +AGS Sbjct: 407 DLFIKVKQSNSDGK----IPNGDHGLFFSNFSLLGTPVLKNISFKIEKGQLLAVAGSTGA 462 Query: 391 SCEELASFFVSSLLKKMGKI 450 L + L GKI Sbjct: 463 GKTSLLMLIMGELEPSEGKI 482
>CS007_MOUSE (Q6ZPZ3) Zinc finger CCCH-type domain-containing protein C19orf7| homolog Length = 1304 Score = 30.8 bits (68), Expect = 3.5 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = -3 Query: 471 CVLHLHCNFSHFLQERRNKERCKFF 397 C HCNFSH ++ + +E CKF+ Sbjct: 403 CTWGDHCNFSHDIELPKKRELCKFY 427
>LKHA4_YEAST (Q10740) Probable leukotriene A-4 hydrolase (EC 3.3.2.6) (LTA-4| hydrolase) (Leukotriene A(4) hydrolase) Length = 671 Score = 29.6 bits (65), Expect = 7.8 Identities = 36/114 (31%), Positives = 50/114 (43%), Gaps = 7/114 (6%) Frame = +1 Query: 307 ELLGSRKAKNTFLLCTASCSD-----IAGSGLDSCEELASFFVSSLLKKMGK--IAMQME 465 E LGSR N ASC+D I D C L +++S K GK + Q+E Sbjct: 134 EPLGSRLVINN-----ASCNDNFTLNIQFRTTDKCTALQ--WLNSKQTKGGKPYVFSQLE 186 Query: 466 DTHMKIVFSCFSMISLKLKTEAEFSTYAVHMLAPLYKVAEGFAGKVITDEVKQS 627 H + +F CF S+K ST+ + +PL V F+G I D K + Sbjct: 187 AIHARSLFPCFDTPSVK-------STFTASIESPLPVV---FSGIRIEDTSKDT 230 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 86,561,274 Number of Sequences: 219361 Number of extensions: 1692872 Number of successful extensions: 4435 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4330 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4434 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5881538857 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)