| Clone Name | bags30b03 |
|---|---|
| Clone Library Name | barley_pub |
>PTG3C_STRPN (P35595) PTS system glucose-specific EIICBA component (EIICBA-Glc)| (EII-Glc/EIII-Glc) [Includes: Glucose permease IIC component (PTS system glucose-specific EIIC component); Glucose-specific phosphotransferase enzyme IIB component (EC 2.7.1.6 Length = 726 Score = 33.5 bits (75), Expect = 0.53 Identities = 15/39 (38%), Positives = 28/39 (71%) Frame = +3 Query: 6 LLRADNSNTPGRNSSFETAEFAEDTDSKVILWSDSASMH 122 +++ N TPGRN ++ETAE +E+T S+V + + S +++ Sbjct: 440 MIQKFNYATPGRNGNYETAEGSEETSSEVKVAAGSQAVN 478
>DAK_PICAN (O60017) Dihydroxyacetone kinase (EC 2.7.1.29) (Glycerone kinase)| (DHA kinase) Length = 609 Score = 32.0 bits (71), Expect = 1.5 Identities = 23/61 (37%), Positives = 33/61 (54%) Frame = +3 Query: 24 SNTPGRNSSFETAEFAEDTDSKVILWSDSASMHPFSEKQSDEFPRSDGSSTAVLQSGMEK 203 + PG NSS+ TAE+A ++S VI D+ + S F S + AVL+SG +K Sbjct: 350 TKVPGWNSSYTTAEWAAKSESFVI---DAPPVSDASATSKVRF--SSSTVKAVLESGCKK 404 Query: 204 L 206 L Sbjct: 405 L 405
>WBP11_HUMAN (Q9Y2W2) WW domain-binding protein 11 (WBP-11) (SH3 domain-binding| protein SNP70) (Npw38-binding protein) (NpwBP) Length = 641 Score = 30.0 bits (66), Expect = 5.8 Identities = 19/45 (42%), Positives = 23/45 (51%) Frame = +3 Query: 54 ETAEFAEDTDSKVILWSDSASMHPFSEKQSDEFPRSDGSSTAVLQ 188 E EF+ED D SD + S+KQ E SDG+STA Q Sbjct: 348 EVEEFSEDDDEDD---SDDSEAEKQSQKQHKEESHSDGTSTASSQ 389
>MOCA_SYNY3 (Q55370) Molybdenum cofactor biosynthesis bifunctional protein| [Includes: Molybdenum cofactor biosynthesis protein C; Molybdopterin-guanine dinucleotide biosynthesis protein A] Length = 347 Score = 29.3 bits (64), Expect = 10.0 Identities = 17/50 (34%), Positives = 26/50 (52%), Gaps = 1/50 (2%) Frame = +3 Query: 453 NTPDLLSPGAFIAPASGVLDKLRSFSQI-MNIVMSDAIPKNTFQIEALIA 599 N P L+ G + P SG+L L+S+ + I+ D N+ +E LIA Sbjct: 220 NLPTLVDRGESVGPMSGILTALQSYPGVNWLIIACDLAYINSTMVEKLIA 269
>GCSH2_ARATH (Q9LQL0) Probable glycine cleavage system H protein 2,| mitochondrial precursor Length = 166 Score = 29.3 bits (64), Expect = 10.0 Identities = 21/80 (26%), Positives = 35/80 (43%), Gaps = 8/80 (10%) Frame = -3 Query: 217 HSLHSFSIPLCRTAVDEPSLRGNSSDCFSENGCILA--------ESLQRITFESVSSANS 62 H L +FSI C ++V E NS + G + + L + F + ANS Sbjct: 24 HLLPAFSISRCFSSVLEGLKYANSHEWVKHEGSVATIGITDHAQDHLGEVVFVELPEANS 83 Query: 61 AVSKDEFLPGVLLLSARNNL 2 +VSK++ V + A + + Sbjct: 84 SVSKEKSFGAVESVKATSEI 103 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 92,080,043 Number of Sequences: 219361 Number of extensions: 1916649 Number of successful extensions: 4497 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4348 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4497 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5767334219 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)