| Clone Name | bags30a01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KBTB3_HUMAN (Q8NAB2) Kelch repeat and BTB domain-containing prot... | 32 | 0.95 | 2 | CD180_HUMAN (Q99467) CD180 antigen precursor (Lymphocyte antigen... | 30 | 4.7 | 3 | TASM_POVJC (P03083) Small T antigen | 29 | 8.1 |
|---|
>KBTB3_HUMAN (Q8NAB2) Kelch repeat and BTB domain-containing protein 3 (BTB and| kelch domain-containing protein 3) Length = 608 Score = 32.0 bits (71), Expect = 0.95 Identities = 22/79 (27%), Positives = 34/79 (43%), Gaps = 12/79 (15%) Frame = -1 Query: 203 RCSKYPSTYIFQFFHEYEDIEGCICPTHLDMTLVS-LYNIQSPHTKAI-----------T 60 +C + +I + +H+ D C CP D LVS + ++ HT + T Sbjct: 349 KCCRTVRLHIAESYHDATDQTWCYCPVKNDFFLVSTMKTPRTMHTSVMALDRLFVIGGKT 408 Query: 59 NSSRSFSILLDVEALPKIS 3 SR LLDVE+ +S Sbjct: 409 RGSRDIKSLLDVESYNPLS 427
>CD180_HUMAN (Q99467) CD180 antigen precursor (Lymphocyte antigen 64)| (Radioprotective 105 kDa protein) Length = 661 Score = 29.6 bits (65), Expect = 4.7 Identities = 28/104 (26%), Positives = 46/104 (44%), Gaps = 3/104 (2%) Frame = +2 Query: 68 LWCEDFECYRER--LGSYLNELGKYNLRYLHIHEKIGKYMLRDTCCTFPYLQHLNLEWS- 238 LW FE + + L L + ++ L++ E + T F LQ L+L + Sbjct: 250 LWLGTFEDIDDEDISSAMLKGLCEMSVESLNLQEHRFSDISSTTFQCFTQLQELDLTATH 309 Query: 239 IKRVPKGMASLTNILKLQIEVLQFDEEDLHVLMCMPSLAYLQLK 370 +K +P GM L + KL + V FD+ PSL +L ++ Sbjct: 310 LKGLPSGMKGLNLLKKLVLSVNHFDQLCQISAANFPSLTHLYIR 353
>TASM_POVJC (P03083) Small T antigen| Length = 172 Score = 28.9 bits (63), Expect = 8.1 Identities = 16/51 (31%), Positives = 25/51 (49%) Frame = +2 Query: 17 ELRHLTKLRKISMSLLWLWCEDFECYRERLGSYLNELGKYNLRYLHIHEKI 169 +LRH + S L+W+ C F+C+R+ G L + LH EK+ Sbjct: 117 KLRHRNRKFLRSSPLVWIDCYCFDCFRQWFGCDLTQ------EALHCWEKV 161 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 71,295,112 Number of Sequences: 219361 Number of extensions: 1495761 Number of successful extensions: 3605 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3528 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3605 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3581144924 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)