| Clone Name | bags29h13 |
|---|---|
| Clone Library Name | barley_pub |
>NR6A1_HUMAN (Q15406) Orphan nuclear receptor NR6A1 (Germ cell nuclear factor)| (GCNF) (Retinoid receptor-related testis-specific receptor) (RTR) Length = 480 Score = 30.4 bits (67), Expect = 1.2 Identities = 16/45 (35%), Positives = 20/45 (44%), Gaps = 6/45 (13%) Frame = -2 Query: 203 LPEAPANGL------HVDPGSAERATGCLEQQICATCGDS*TSTH 87 LP P NG +DPG+ + EQ+ C CGD T H Sbjct: 27 LPPPPRNGFCQDELAELDPGTISVSDDRAEQRTCLICGDRATGLH 71
>PAAD_THEAC (Q9HJ72) Probable aromatic acid decarboxylase (EC 4.1.1.-)| Length = 180 Score = 30.4 bits (67), Expect = 1.2 Identities = 17/36 (47%), Positives = 26/36 (72%), Gaps = 1/36 (2%) Frame = +3 Query: 51 FLKICLIISPCNMGTCSRIAAGCAD-LLFQAASRSL 155 FL ++I PC++ T S+IAAG +D L+ +AA+ SL Sbjct: 73 FLFDSMVIVPCSITTISKIAAGISDTLITRAAAVSL 108
>HBB_MERMR (O13078) Hemoglobin beta subunit (Hemoglobin beta chain)| (Beta-globin) Length = 146 Score = 28.9 bits (63), Expect = 3.6 Identities = 19/49 (38%), Positives = 25/49 (51%), Gaps = 1/49 (2%) Frame = -2 Query: 221 STYAXHLPEAPANGLHVDPGSAERATGCLEQQICATCGDS*T-STHVAW 78 +TYA L + ++ LHVDP + CL I A G + T T VAW Sbjct: 83 NTYA-ELSQLHSDKLHVDPDNFRLLADCLTVVIAAKMGTAFTVETQVAW 130
>TTKA_DROME (P42282) Protein tramtrack, alpha isoform (Tramtrack p88)| (Repressor protein fushi tarazu) Length = 813 Score = 28.5 bits (62), Expect = 4.7 Identities = 11/23 (47%), Positives = 16/23 (69%), Gaps = 2/23 (8%) Frame = +2 Query: 26 PCPICSEKVSK--DMLNHITMQH 88 PCP+CS++ S+ M NH+ M H Sbjct: 647 PCPVCSKEFSRPDKMKNHLKMTH 669
>P2RX7_MOUSE (Q9Z1M0) P2X purinoceptor 7 (ATP receptor) (P2X7) (Purinergic| receptor) (P2Z receptor) Length = 595 Score = 28.5 bits (62), Expect = 4.7 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = +3 Query: 105 IAAGCADLLFQAASRSLC*AGIYVKPICRC 194 +A C DLL S + C +G+Y P C+C Sbjct: 346 LATVCIDLLINTYSSAFCRSGVY--PYCKC 373
>HR38_DROME (P49869) Probable nuclear hormone receptor HR38 (dHR38)| Length = 1073 Score = 28.5 bits (62), Expect = 4.7 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 3/52 (5%) Frame = -2 Query: 233 HYCCSTYAXHLPEAPANGLHVDPGSAERATGCLEQ---QICATCGDS*TSTH 87 H +A L AP N P SA+ G L Q Q+CA CGD+ H Sbjct: 705 HSHAHAHALQLNSAP-NSAASSPASADLQAGRLLQAPSQLCAVCGDTAACQH 755
>UREE_EDWIC (Q6J171) Urease accessory protein ureE| Length = 225 Score = 27.7 bits (60), Expect = 8.1 Identities = 10/28 (35%), Positives = 20/28 (71%) Frame = +2 Query: 32 PICSEKVSKDMLNHITMQHGYLFKNRRR 115 P+ +EK+ L+++T++HG ++KN R Sbjct: 15 PVWAEKLKAYELDYLTLEHGDMYKNSCR 42 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,141,468 Number of Sequences: 219361 Number of extensions: 568457 Number of successful extensions: 2068 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 2054 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2068 length of database: 80,573,946 effective HSP length: 62 effective length of database: 66,973,564 effective search space used: 1607365536 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)