| Clone Name | bags28m02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PMT4_YEAST (P46971) Dolichyl-phosphate-mannose--protein mannosyl... | 36 | 0.099 |
|---|
>PMT4_YEAST (P46971) Dolichyl-phosphate-mannose--protein mannosyltransferase 4| (EC 2.4.1.109) Length = 762 Score = 35.8 bits (81), Expect = 0.099 Identities = 16/48 (33%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +3 Query: 195 GFHPRGRNFRCKLYEPVLVFFTMTCSHHFRW--RVRSRAFHHY*PCRI 332 G++ + R KLY P++ FF C H+F + R + HHY P + Sbjct: 624 GYYALNKMTREKLYGPLMFFFVSWCCHYFPFFLMARQKFLHHYLPAHL 671 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,543,023 Number of Sequences: 219361 Number of extensions: 1972114 Number of successful extensions: 5198 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4913 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5183 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5367617986 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)