| Clone Name | bags28l06 |
|---|---|
| Clone Library Name | barley_pub |
>IBBWP_MAIZE (P31862) Bowman-Birk type wound-induced proteinase inhibitor WIP1| precursor Length = 102 Score = 46.2 bits (108), Expect = 6e-05 Identities = 26/61 (42%), Positives = 29/61 (47%), Gaps = 4/61 (6%) Frame = +3 Query: 138 KCCNNCR-SFSGVDVCDDAHPKCPKGCSACRV---VTPSPHKTFRCADMKSTVDGTCGGP 305 KCC NC SFSG+ CDD C C C V + S + FRC D T G CG Sbjct: 45 KCCTNCNFSFSGLYTCDDVKKDCDPVCKKCVVAVHASYSGNNKFRCTD---TFLGMCGPK 101 Query: 306 C 308 C Sbjct: 102 C 102
>PKSJ_BACSU (P40806) Putative polyketide synthase pksJ (PKS)| Length = 5045 Score = 32.0 bits (71), Expect = 1.3 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 2/44 (4%) Frame = -1 Query: 295 QVPSTVLFMSAQRNVL*GL--GVTTRQAEQPLGHLGWASSQTST 170 Q+P T +FMSA N L TT E P G++ W +Q+ T Sbjct: 1869 QIPQTSVFMSASNNSYRALLPSDTTESLETPDGYVSWVLAQSGT 1912
>FPG_DEIRA (Q9RX22) Formamidopyrimidine-DNA glycosylase (EC 3.2.2.23)| (Fapy-DNA glycosylase) (DNA-(apurinic or apyrimidinic site) lyase mutM) (EC 4.2.99.18) (AP lyase mutM) Length = 279 Score = 30.8 bits (68), Expect = 2.8 Identities = 18/51 (35%), Positives = 25/51 (49%) Frame = -1 Query: 229 TRQAEQPLGHLGWASSQTSTPEKDLQLLQHLGKKSAFTWERIPMTRTAWRM 77 TR+ + L HL A + P DL+L+ HLG F E P TR + + Sbjct: 48 TRRGKYLLLHLAAADAAEDEPH-DLELIVHLGMTGGFRLEEGPHTRVTFEL 97
>ZPBP1_HUMAN (Q9BS86) Zona pellucida-binding protein 1 precursor (Sp38)| Length = 351 Score = 30.0 bits (66), Expect = 4.8 Identities = 13/43 (30%), Positives = 19/43 (44%) Frame = +3 Query: 156 RSFSGVDVCDDAHPKCPKGCSACRVVTPSPHKTFRCADMKSTV 284 R F G + HPKCP+ C C + +P C S++ Sbjct: 301 RCFPGYGMNVQQHPKCPECCVICSPGSYNPRDGIHCLQCNSSL 343
>IBB1_ARAHY (P01066) Bowman-Birk type proteinase inhibitor A-II [Contains:| Bowman-Birk type proteinase inhibitor A-I; Bowman-Birk type proteinase inhibitor B-I; Bowman-Birk type proteinase inhibitor B-III] Length = 70 Score = 29.6 bits (65), Expect = 6.3 Identities = 17/48 (35%), Positives = 19/48 (39%), Gaps = 5/48 (10%) Frame = +3 Query: 141 CCNNCRSFSGVD-----VCDDAHPKCPKGCSACRVVTPSPHKTFRCAD 269 CCN C VC D CP C++C V T S RC D Sbjct: 11 CCNGCLCDRRAPPYFECVCVDTFDHCPASCNSC-VCTRSNPPQCRCTD 57
>LCE5A_HUMAN (Q5TCM9) Late cornified envelope protein 5A (Late envelope protein| 18) (Small proline-rich-like epidermal differentiation complex protein 5A) Length = 118 Score = 29.6 bits (65), Expect = 6.3 Identities = 29/92 (31%), Positives = 30/92 (32%), Gaps = 4/92 (4%) Frame = +3 Query: 135 PKCCNNCRSFSGVDVCDDAHPKCPKGCSACRVVTPSPHKTFRCADMKSTVDGTC----GG 302 PKC C PKCP CSA P P C S+ G C GG Sbjct: 14 PKCTPKCPPKCTPKCPPKCPPKCPPQCSA-----PCPPPVSSCCG--SSSGGCCSSEGGG 66 Query: 303 PCKKH*SLQGFRLGRGVPPRIKLR*DEQSSCC 398 C H PR LR QSS C Sbjct: 67 CCLSH-----------HRPRQSLRRRPQSSSC 87 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 55,523,644 Number of Sequences: 219361 Number of extensions: 1014827 Number of successful extensions: 2765 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2679 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2760 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4757699440 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)