| Clone Name | bags28d01 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AGRN_RAT (P25304) Agrin precursor | 30 | 6.0 | 2 | AGRN_HUMAN (O00468) Agrin precursor | 30 | 6.0 | 3 | DSBD_NEIMA (Q9JTL9) Thiol:disulfide interchange protein dsbD pre... | 30 | 7.9 |
|---|
>AGRN_RAT (P25304) Agrin precursor| Length = 1959 Score = 30.0 bits (66), Expect = 6.0 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +3 Query: 513 CKYSCLYSEIFLS----PVCGCGRIVCRYLLHSVCALIGQ*YMCSWW 641 C +C ++ + LS P C C R+ C VCA G Y W Sbjct: 290 CPETCQFNSVCLSRRGRPHCSCDRVTCDGSYRPVCAQDGHTYNNDCW 336
>AGRN_HUMAN (O00468) Agrin precursor| Length = 2045 Score = 30.0 bits (66), Expect = 6.0 Identities = 15/47 (31%), Positives = 20/47 (42%), Gaps = 4/47 (8%) Frame = +3 Query: 513 CKYSCLYSEIFLS----PVCGCGRIVCRYLLHSVCALIGQ*YMCSWW 641 C C ++ + LS P C C R+ C VCA G+ Y W Sbjct: 395 CPEPCRFNAVCLSRRGRPRCSCDRVTCDGAYRPVCAQDGRTYDSDCW 441
>DSBD_NEIMA (Q9JTL9) Thiol:disulfide interchange protein dsbD precursor (EC| 1.8.1.8) (Protein-disulfide reductase) (Disulfide reductase) Length = 601 Score = 29.6 bits (65), Expect = 7.9 Identities = 23/69 (33%), Positives = 35/69 (50%) Frame = -1 Query: 348 FVLKAVDVQLLSLYFSLVGIVSWLGKQLLGHYITVADLLSHSMMFNY*HK*QLHRQINIY 169 FVL V VQ LSL ++LVGIV+ L LL ++ A ++ + + NI Sbjct: 231 FVLSVVYVQGLSLTYTLVGIVAGLTGALLTVWLQQAWVVLAASALMVVLALSMFGLFNIQ 290 Query: 168 TPSSMFGYF 142 P+++ YF Sbjct: 291 LPNAVQSYF 299 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 87,263,327 Number of Sequences: 219361 Number of extensions: 1675389 Number of successful extensions: 3223 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 3157 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3223 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 5972710590 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)