| Clone Name | bags27l08 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YOW1_SCHPO (Q9USR9) Hypothetical protein C1861.01c in chromosome II | 30 | 3.7 |
|---|
>YOW1_SCHPO (Q9USR9) Hypothetical protein C1861.01c in chromosome II| Length = 643 Score = 30.4 bits (67), Expect = 3.7 Identities = 18/49 (36%), Positives = 29/49 (59%) Frame = -1 Query: 531 EPSSQFSVNPDSNEFSNASSSDMAT*GNAMENSELEKDSFRMSAKAGST 385 +P+S +VN S+E S+ASSSD + + +S L +S + A GS+ Sbjct: 76 QPTSPMAVNAASDEASHASSSDSSDKNPDIPSSPLLMNSRALRASRGSS 124 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 69,759,754 Number of Sequences: 219361 Number of extensions: 1143135 Number of successful extensions: 3160 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3091 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3158 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4815021120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)