| Clone Name | bags26p18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CBL11_ARATH (Q9T045) COBRA-like protein 11 precursor | 32 | 1.5 | 2 | HYUC_PSESN (Q01264) Hydantoin utilization protein C (ORF4) | 30 | 4.3 | 3 | VT4_SHEVN (P18385) T4 protein | 30 | 4.3 | 4 | VT4_SHEVK (P18386) T4 protein | 30 | 4.3 | 5 | ATX3_ARATH (Q9M364) Histone-lysine N-methyltransferase ATX3 (EC ... | 30 | 5.6 | 6 | VIF_SIVGB (P22383) Virion infectivity factor (Vif) (SOR protein)... | 30 | 5.6 | 7 | SPT7_YEAST (P35177) Transcriptional activator SPT7 | 29 | 9.6 |
|---|
>CBL11_ARATH (Q9T045) COBRA-like protein 11 precursor| Length = 668 Score = 32.0 bits (71), Expect = 1.5 Identities = 19/49 (38%), Positives = 24/49 (48%), Gaps = 6/49 (12%) Frame = -1 Query: 229 NPTLTQTHMMENSSKK------HVFPRNVSRTAVLHPRTWK*IATMNPT 101 N TL THM + SK + P + +RTA PR WK +NPT Sbjct: 329 NGTLLPTHMDPSKSKAIFQLQVYKVPPDQNRTAFFPPRNWKIDGIVNPT 377
>HYUC_PSESN (Q01264) Hydantoin utilization protein C (ORF4)| Length = 414 Score = 30.4 bits (67), Expect = 4.3 Identities = 14/46 (30%), Positives = 27/46 (58%) Frame = -1 Query: 313 LIRIWKVGMLFMKCRHVLDHLSQMNRIMNPTLTQTHMMENSSKKHV 176 L I ++GM+F++CR+ + H + ++ LT T ++ S KH+ Sbjct: 369 LAEITEIGMVFVRCRNGISHSPKEWAEIDDILTGTKVLYESIIKHI 414
>VT4_SHEVN (P18385) T4 protein| Length = 240 Score = 30.4 bits (67), Expect = 4.3 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +3 Query: 450 LEPITFEDYDVRWVFTIELKFINCFNSSIILDN 548 +E ++F+DYD+ +V T ++ + +SS+I+ N Sbjct: 144 VESVSFKDYDLEFVITTDISCVKHVSSSVIVRN 176
>VT4_SHEVK (P18386) T4 protein| Length = 240 Score = 30.4 bits (67), Expect = 4.3 Identities = 11/33 (33%), Positives = 23/33 (69%) Frame = +3 Query: 450 LEPITFEDYDVRWVFTIELKFINCFNSSIILDN 548 +E ++F+DYD+ +V T ++ + +SS+I+ N Sbjct: 144 VESVSFKDYDLEFVITTDISCVKHVSSSVIVRN 176
>ATX3_ARATH (Q9M364) Histone-lysine N-methyltransferase ATX3 (EC 2.1.1.43)| (Trithorax-homolog protein 3) (TRX-homolog protein 3) (Protein SET DOMAIN GROUP 14) Length = 902 Score = 30.0 bits (66), Expect = 5.6 Identities = 16/60 (26%), Positives = 28/60 (46%), Gaps = 4/60 (6%) Frame = -3 Query: 464 CYWFQPKETGRTHEH----IGLVEINPNTHLDVHDVYITAQQATQVFYLLWACQTDQNLE 297 C WF+P+ HE+ +GL +I N+ L H + + F+ + A + N+E Sbjct: 571 CAWFRPEVGFLNHENMEPAVGLFKIPANSFLKTHGSCVHCCKCATHFHAMCASRAGYNME 630
>VIF_SIVGB (P22383) Virion infectivity factor (Vif) (SOR protein) (Q protein)| Length = 172 Score = 30.0 bits (66), Expect = 5.6 Identities = 13/35 (37%), Positives = 18/35 (51%) Frame = +3 Query: 498 IELKFINCFNSSIILDNTFVGSRDTTICRFPVGHR 602 I L F +CF S ++ G +CRFP GH+ Sbjct: 118 IHLHFYDCFMDSAVM-KAIRGEEVLKVCRFPAGHK 151
>SPT7_YEAST (P35177) Transcriptional activator SPT7| Length = 1332 Score = 29.3 bits (64), Expect = 9.6 Identities = 22/94 (23%), Positives = 43/94 (45%), Gaps = 6/94 (6%) Frame = -3 Query: 374 DVYITAQQATQVFYLLWACQTDQNLEGW--YVVYEVSPRVRPPLPNEQDYEPH--INP-- 213 D+Y+T+QQ + YLL + L+ W ++ ++ V P Q+ E H ++P Sbjct: 32 DLYLTSQQLVVLEYLLSISSEEDKLKAWDYFLKGNIALNVEKSFPLTQEEEHHGAVSPAV 91 Query: 212 DTYDGEFFQETRLSKKCFKNRRASPQNMEVDSDN 111 DT + +S + K+ + N + ++N Sbjct: 92 DTRSDD------VSSQTIKDNNNTNTNTSISNEN 119 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,683,413 Number of Sequences: 219361 Number of extensions: 1950046 Number of successful extensions: 4563 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4443 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4561 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5538924943 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)