ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags26l10 |
|---|---|
| Clone Library Name | barley_pub |
>VN53_ROTSP (P35425) Nonstructural RNA-binding protein 53 (NS53) (NCVP2)| Length = 495 Score = 32.0 bits (71), Expect = 1.4 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 2/53 (3%) Frame = +1 Query: 190 RLCKVAKEMLWTTMCHAKKIGKLDNCWCWNVCQFCDL--CWIIFVSTAVDWCI 342 RLC + +W + AK G WC CQ DL C+ + WC+ Sbjct: 20 RLCNIGANSIWMPVPDAKIKG-----WCLECCQIADLTHCYGCSLPHVCKWCV 67
>RND3_RAT (Q6SA80) Rho-related GTP-binding protein RhoE (Rho family GTPase 3)| (Rnd3) Length = 244 Score = 30.4 bits (67), Expect = 4.0 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 5/75 (6%) Frame = -3 Query: 497 QLGKAEEISCSARQSISKSSIR-----VTRRGIQECRKKNKHANSSTQVHLLSQMPTMHQ 333 Q+G A I CSA Q S++S+R T + + K K S +S MP+ + Sbjct: 168 QIGAATYIECSALQ--SENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPE 225 Query: 332 STAVETKIIQHKSQN 288 +AV T + + K+++ Sbjct: 226 LSAVATDLRKDKAKS 240
>RND3_PONPY (Q5R9F4) Rho-related GTP-binding protein RhoE (Rho family GTPase 3)| (Rnd3) Length = 244 Score = 30.4 bits (67), Expect = 4.0 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 5/75 (6%) Frame = -3 Query: 497 QLGKAEEISCSARQSISKSSIR-----VTRRGIQECRKKNKHANSSTQVHLLSQMPTMHQ 333 Q+G A I CSA Q S++S+R T + + K K S +S MP+ + Sbjct: 168 QIGAATYIECSALQ--SENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPE 225 Query: 332 STAVETKIIQHKSQN 288 +AV T + + K+++ Sbjct: 226 LSAVATDLRKDKAKS 240
>RND3_PIG (O77683) Rho-related GTP-binding protein RhoE (Rho family GTPase 3)| (Rnd3) (Rho8) Length = 244 Score = 30.4 bits (67), Expect = 4.0 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 5/75 (6%) Frame = -3 Query: 497 QLGKAEEISCSARQSISKSSIR-----VTRRGIQECRKKNKHANSSTQVHLLSQMPTMHQ 333 Q+G A I CSA Q S++S+R T + + K K S +S MP+ + Sbjct: 168 QIGAATYIECSALQ--SENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPE 225 Query: 332 STAVETKIIQHKSQN 288 +AV T + + K+++ Sbjct: 226 LSAVATDLRKDKAKS 240
>RND3_MOUSE (P61588) Rho-related GTP-binding protein RhoE (Rho family GTPase 3)| (Rnd3) Length = 244 Score = 30.4 bits (67), Expect = 4.0 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 5/75 (6%) Frame = -3 Query: 497 QLGKAEEISCSARQSISKSSIR-----VTRRGIQECRKKNKHANSSTQVHLLSQMPTMHQ 333 Q+G A I CSA Q S++S+R T + + K K S +S MP+ + Sbjct: 168 QIGAATYIECSALQ--SENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPE 225 Query: 332 STAVETKIIQHKSQN 288 +AV T + + K+++ Sbjct: 226 LSAVATDLRKDKAKS 240
>RND3_HUMAN (P61587) Rho-related GTP-binding protein RhoE (Rho family GTPase 3)| (Rnd3) (Rho8) (MemB protein) Length = 244 Score = 30.4 bits (67), Expect = 4.0 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 5/75 (6%) Frame = -3 Query: 497 QLGKAEEISCSARQSISKSSIR-----VTRRGIQECRKKNKHANSSTQVHLLSQMPTMHQ 333 Q+G A I CSA Q S++S+R T + + K K S +S MP+ + Sbjct: 168 QIGAATYIECSALQ--SENSVRDIFHVATLACVNKTNKNVKRNKSQRATKRISHMPSRPE 225 Query: 332 STAVETKIIQHKSQN 288 +AV T + + K+++ Sbjct: 226 LSAVATDLRKDKAKS 240
>CLOCK_HUMAN (O15516) Circadian locomoter output cycles protein kaput (hCLOCK)| Length = 846 Score = 30.4 bits (67), Expect = 4.0 Identities = 17/47 (36%), Positives = 25/47 (53%) Frame = -3 Query: 389 HANSSTQVHLLSQMPTMHQSTAVETKIIQHKSQNWQTFQHQQLSNLP 249 H N STQ+ L + P + QST ++ QH+SQ Q + +LP Sbjct: 793 HGNPSTQLILSAAFP-LQQSTFPQSHHQQHQSQQQQQLSRHRTDSLP 838
>PHF14_HUMAN (O94880) PHD finger protein 14| Length = 888 Score = 30.0 bits (66), Expect = 5.2 Identities = 16/46 (34%), Positives = 23/46 (50%), Gaps = 3/46 (6%) Frame = -3 Query: 407 CRKKNKHA---NSSTQVHLLSQMPTMHQSTAVETKIIQHKSQNWQT 279 C+KK NS+ L + T+ QS + E +I KSQNW + Sbjct: 268 CKKKKSKVLSRNSADDEELTNDSLTLSQSKSNEDSLILEKSQNWSS 313
>DPO3X_MYCGE (P47658) DNA polymerase III gamma/tau subunit (EC 2.7.7.7)| Length = 597 Score = 30.0 bits (66), Expect = 5.2 Identities = 15/35 (42%), Positives = 20/35 (57%), Gaps = 3/35 (8%) Frame = +1 Query: 238 AKKIGKLDNCWCWN---VCQFCDLCWIIFVSTAVD 333 AK I K NC W+ VC CD+C I ++A+D Sbjct: 54 AKIIAKAINCLNWDQIDVCNSCDVCKSINTNSAID 88
>AD26A_MOUSE (Q9R158) ADAM 26A precursor (EC 3.4.24.-) (A disintegrin and| metalloproteinase domain 26A) (Testase-3) Length = 697 Score = 29.6 bits (65), Expect = 6.8 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = -2 Query: 351 DANNAPINCGGDKNNPAQVTKLANIPAPAIIQFANLLCMTH 229 D+ ++P+ CG + AQ TKL AP ++Q TH Sbjct: 153 DSESSPMRCGLSEEETAQQTKLQESNAPTLLQIPYENWWTH 193
>DPO3X_MYCPN (P75177) DNA polymerase III gamma/tau subunit (EC 2.7.7.7)| Length = 681 Score = 29.6 bits (65), Expect = 6.8 Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = +1 Query: 238 AKKIGKLDNCWCWN--VCQFCDLCWIIFVSTAVD 333 AK I K NC WN VC C+ C I ++A+D Sbjct: 54 AKIIAKAINCLNWNGDVCNQCEACQAINSNSAID 87
>UL49_EBV (P14347) Protein BFRF2| Length = 591 Score = 29.3 bits (64), Expect = 8.9 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -1 Query: 406 AGRKISTPIHPPKFTFCLRCQQCTN 332 A R +S P +PP FC+ C C N Sbjct: 373 ASRPVSGPDYPPLAVFCMDCGYCLN 397
>PHF14_MOUSE (Q9D4H9) PHD finger protein 14| Length = 881 Score = 29.3 bits (64), Expect = 8.9 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = -3 Query: 419 GIQECRKKNKHANSSTQVHLLSQMPTMHQSTAVETKIIQHKSQNWQT 279 G ++ R K NS+ L + T+ QS + E +I KSQNW + Sbjct: 260 GGKKKRSKVLSRNSADDEELTNDSLTLSQSKSNEDSLILEKSQNWSS 306
>FGD1_MOUSE (P52734) FYVE, RhoGEF and PH domain-containing protein 1| (Faciogenital dysplasia 1 protein homolog) (Zinc finger FYVE domain-containing protein 3) (Rho/Rac guanine nucleotide exchange factor FGD1) (Rho/Rac GEF) Length = 960 Score = 29.3 bits (64), Expect = 8.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 403 GRKISTPIHPPKFTFCLRCQQCTNQLRWRQ 314 G++ TPI + T C+RCQ+ N + R+ Sbjct: 720 GKRAPTPIREKEVTMCMRCQEPFNSITKRR 749
>FGD1_HUMAN (P98174) FYVE, RhoGEF and PH domain-containing protein 1| (Faciogenital dysplasia 1 protein) (Zinc finger FYVE domain-containing protein 3) (Rho/Rac guanine nucleotide exchange factor FGD1) (Rho/Rac GEF) Length = 961 Score = 29.3 bits (64), Expect = 8.9 Identities = 11/30 (36%), Positives = 18/30 (60%) Frame = -1 Query: 403 GRKISTPIHPPKFTFCLRCQQCTNQLRWRQ 314 G++ TPI + T C+RCQ+ N + R+ Sbjct: 721 GKRAPTPIREKEVTMCMRCQEPFNSITKRR 750
>NUDH_IDILO (Q5R053) Probable (di)nucleoside polyphosphate hydrolase (EC| 3.6.1.-) Length = 170 Score = 29.3 bits (64), Expect = 8.9 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 1/46 (2%) Frame = +1 Query: 22 VFVAIGLDLENQPVYYICRQ*LRY-LPKRLVKQSRVQALPLGSREK 156 ++ +GL E + Y RQ LRY LPKRL+++ + + + +G ++K Sbjct: 54 LYEEVGLKPEQVEILYTSRQWLRYRLPKRLIRREQ-RPMCVGQKQK 98 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 81,126,380 Number of Sequences: 219361 Number of extensions: 1584054 Number of successful extensions: 4047 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 3916 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4046 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 5158951200 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
