| Clone Name | bags26k13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NALP4_HUMAN (Q96MN2) NACHT-, LRR- and PYD-containing protein 4 (... | 30 | 4.3 | 2 | JHD2B_MOUSE (Q6ZPY7) JmjC domain-containing histone demethylatio... | 29 | 7.3 | 3 | CLS_WIGBR (Q8D2I8) Cardiolipin synthetase (EC 2.7.8.-) (Cardioli... | 29 | 7.3 |
|---|
>NALP4_HUMAN (Q96MN2) NACHT-, LRR- and PYD-containing protein 4 (PYRIN-containing| APAF1-like protein 4) (PAAD and NACHT-containing protein 2) (PYRIN and NACHT-containing protein 2) (Ribonuclease inhibitor 2) Length = 994 Score = 30.0 bits (66), Expect = 4.3 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +2 Query: 230 VVCTQTTHPQCLMKLQGRKHTDLDDE 307 V+C HP+C +++ G + TD D+E Sbjct: 940 VLCEALRHPECALQVLGLRKTDFDEE 965
>JHD2B_MOUSE (Q6ZPY7) JmjC domain-containing histone demethylation protein 2B| (EC 1.14.11.-) (Jumonji domain-containing protein 1B) Length = 1562 Score = 29.3 bits (64), Expect = 7.3 Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 10/56 (17%) Frame = -3 Query: 221 GTGRNQS-GMSA---------YLCAIEDESMTLHDLSINFFMECNSRPNGSKNFIS 84 G+GR+QS G+ A + C+ ES DLS N F +C S+ S N++S Sbjct: 287 GSGRSQSNGVLATDNKPLGFSFSCSSASESQKDSDLSKNLFFQCMSQNVPSTNYLS 342
>CLS_WIGBR (Q8D2I8) Cardiolipin synthetase (EC 2.7.8.-) (Cardiolipin synthase)| (CL synthase) Length = 495 Score = 29.3 bits (64), Expect = 7.3 Identities = 17/55 (30%), Positives = 25/55 (45%), Gaps = 9/55 (16%) Frame = -2 Query: 477 NVLHVENNLSRRKL--GPGCKQDHTRNYLLI-------LAVFPTPYLVPSSDAAH 340 N++ +NN + + GPG + LL + + TPYLVPS D H Sbjct: 307 NIIKKDNNYKTQVIPSGPGVSEGVIHQVLLTAIYSAKKILIMTTPYLVPSDDILH 361 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 83,271,056 Number of Sequences: 219361 Number of extensions: 1760637 Number of successful extensions: 4194 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4015 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4194 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4200495993 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)