ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags26j17 |
|---|---|
| Clone Library Name | barley_pub |
>BCL9_HUMAN (O00512) B-cell lymphoma 9 protein (Bcl-9) (Legless homolog)| Length = 1426 Score = 35.8 bits (81), Expect = 0.10 Identities = 28/87 (32%), Positives = 38/87 (43%), Gaps = 1/87 (1%) Frame = +3 Query: 42 DQMPQVQSPAIDSLDVANQMQNNGVCGEPRNPFLHPDDTLTAASQLPGMLPYASQKAQQN 221 D P Q P + ANQ QN+ +N L P + A + P P + Sbjct: 230 DPKPLPQQPPVP----ANQDQNSS-----QNTRLQPTPPIPAPAPKPAAPPRPLDRESPG 280 Query: 222 QNHQLLPSIDMPASG-PCPPSFADGTG 299 ++L+PS+ PAS P PP DGTG Sbjct: 281 VENKLIPSVGSPASSTPLPP---DGTG 304
>PYGO_DROME (Q9V9W8) Protein pygopus (Protein gammy legs)| Length = 815 Score = 33.1 bits (74), Expect = 0.67 Identities = 26/81 (32%), Positives = 32/81 (39%), Gaps = 10/81 (12%) Frame = +3 Query: 63 SPAIDSLDVANQMQNNG---------VCGEPRNPFLHPDDTLTAAS-QLPGMLPYASQKA 212 SPA L V MQ+NG P P L P T T+ S +P P + Sbjct: 427 SPAAGRLGVPTSMQSNGPSVSSVASSSVPSPATPTLTPTSTATSMSTSVPTSSPAPPAMS 486 Query: 213 QQNQNHQLLPSIDMPASGPCP 275 + + PS MP SGP P Sbjct: 487 PHHSLNSAGPSPGMPNSGPSP 507
>LACG_STAAW (P67769) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +2 Query: 389 VLHIPNERPEYHLAYITRRGVGYR----RSEQTSHRREEIWY 502 ++ + + P YH YIT G+GY+ SE+T H I Y Sbjct: 358 IMRVVKDYPNYHKIYITENGLGYKDEFIESEKTVHDDARIDY 399
>LACG_STAAU (P11175) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +2 Query: 389 VLHIPNERPEYHLAYITRRGVGYR----RSEQTSHRREEIWY 502 ++ + + P YH YIT G+GY+ SE+T H I Y Sbjct: 358 IMRVVKDYPNYHKIYITENGLGYKDEFIESEKTVHDDARIDY 399
>LACG_STAAS (Q6G7C5) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +2 Query: 389 VLHIPNERPEYHLAYITRRGVGYR----RSEQTSHRREEIWY 502 ++ + + P YH YIT G+GY+ SE+T H I Y Sbjct: 358 IMRVVKDYPNYHKIYITENGLGYKDEFIESEKTVHDDARIDY 399
>LACG_STAAR (Q6GEP0) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +2 Query: 389 VLHIPNERPEYHLAYITRRGVGYR----RSEQTSHRREEIWY 502 ++ + + P YH YIT G+GY+ SE+T H I Y Sbjct: 358 IMRVVKDYPNYHKIYITENGLGYKDEFIESEKTVHDDARIDY 399
>LACG_STAAN (P67768) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +2 Query: 389 VLHIPNERPEYHLAYITRRGVGYR----RSEQTSHRREEIWY 502 ++ + + P YH YIT G+GY+ SE+T H I Y Sbjct: 358 IMRVVKDYPNYHKIYITENGLGYKDEFIESEKTVHDDARIDY 399
>LACG_STAAM (P67767) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +2 Query: 389 VLHIPNERPEYHLAYITRRGVGYR----RSEQTSHRREEIWY 502 ++ + + P YH YIT G+GY+ SE+T H I Y Sbjct: 358 IMRVVKDYPNYHKIYITENGLGYKDEFIESEKTVHDDARIDY 399
>LACG_STAAC (Q5HE16) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 32.0 bits (71), Expect = 1.5 Identities = 15/42 (35%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +2 Query: 389 VLHIPNERPEYHLAYITRRGVGYR----RSEQTSHRREEIWY 502 ++ + + P YH YIT G+GY+ SE+T H I Y Sbjct: 358 IMRVVKDYPNYHKIYITENGLGYKDEFIESEKTVHDDARIDY 399
>YCC3_YEAST (P25563) Hypothetical 13.5 kDa protein in AGP1-LEU2 intergenic| region Length = 115 Score = 31.2 bits (69), Expect = 2.5 Identities = 13/19 (68%), Positives = 14/19 (73%) Frame = -3 Query: 569 LSGATKAQCCMICPWPYST 513 L+GATKAQC PW YST Sbjct: 12 LAGATKAQCFTKLPWAYST 30
>SVL3_YEAST (Q03088) Styryl dye vacuolar localization protein 3| Length = 825 Score = 30.4 bits (67), Expect = 4.3 Identities = 23/94 (24%), Positives = 35/94 (37%) Frame = +3 Query: 15 APFMNNHLPDQMPQVQSPAIDSLDVANQMQNNGVCGEPRNPFLHPDDTLTAASQLPGMLP 194 AP +NNH+P Q Q + ++V N NN V NP + + + A Q Sbjct: 700 APSLNNHVPTQR---QFSSSTMIEVTN--NNNKVNNSSSNPDISTNSVVHNAMQFTNTNN 754 Query: 195 YASQKAQQNQNHQLLPSIDMPASGPCPPSFADGT 296 S N + P S P P+ + + Sbjct: 755 NTSSTVDINDPKNIAPPPTTSVSAPSTPTLSSSS 788
>LACG_STAES (Q8CNF8) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 30.4 bits (67), Expect = 4.3 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = +2 Query: 389 VLHIPNERPEYHLAYITRRGVGYR----RSEQTSHRREEIWY 502 ++ + + P YH YIT G+GY+ E+T H I Y Sbjct: 358 IMRVVKDYPNYHKIYITENGLGYKDVFDEKEKTVHDDARIDY 399
>LACG_STAEQ (Q5HM41) 6-phospho-beta-galactosidase (EC 3.2.1.85)| (Beta-D-phosphogalactoside galactohydrolase) (PGALase) (P-beta-Gal) (PBG) Length = 470 Score = 30.4 bits (67), Expect = 4.3 Identities = 14/42 (33%), Positives = 21/42 (50%), Gaps = 4/42 (9%) Frame = +2 Query: 389 VLHIPNERPEYHLAYITRRGVGYR----RSEQTSHRREEIWY 502 ++ + + P YH YIT G+GY+ E+T H I Y Sbjct: 358 IMRVVKDYPNYHKIYITENGLGYKDVFDEKEKTVHDDARIDY 399
>RF3_CHRVO (Q7NVF7) Peptide chain release factor 3 (RF-3)| Length = 536 Score = 30.0 bits (66), Expect = 5.7 Identities = 19/50 (38%), Positives = 30/50 (60%), Gaps = 6/50 (12%) Frame = -2 Query: 132 FLAHHRH---HCFAS---GLPHRGNR*LEIGPEAFDRGDDCS*TVLPFFA 1 F++H R FA G+P+ GN ++IG ++F G+D + T +PFFA Sbjct: 349 FMSHDREIVEEAFAGDIIGIPNHGN--IQIG-DSFSEGEDLAFTGIPFFA 395
>GSEP_BACLD (P80057) Glutamyl endopeptidase precursor (EC 3.4.21.19)| (Glutamate-specific endopeptidase) (GSE) Length = 316 Score = 30.0 bits (66), Expect = 5.7 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +2 Query: 5 KKGSTVYEQSSPRSNASGPIS 67 + GS V+EQSS R+N SGP S Sbjct: 260 QSGSPVFEQSSSRTNCSGPCS 280
>APC9_YEAST (Q12107) Anaphase-promoting complex subunit 9| Length = 265 Score = 29.3 bits (64), Expect = 9.7 Identities = 12/25 (48%), Positives = 18/25 (72%) Frame = -3 Query: 110 IVLHLVCHIEGIDSWRLDLRHLIGE 36 +V H V H++GIDS+R D+ + GE Sbjct: 120 LVFHKVGHLDGIDSYRPDIDIMCGE 144 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,694,326 Number of Sequences: 219361 Number of extensions: 2172627 Number of successful extensions: 5092 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 4930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5092 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5596027262 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
