ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags26d24 |
|---|---|
| Clone Library Name | barley_pub |
>SFR16_HUMAN (Q8N2M8) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) Length = 659 Score = 37.0 bits (84), Expect = 0.012 Identities = 22/48 (45%), Positives = 32/48 (66%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 L+PS+SR +RS SP+PS Q+ + S+SR QS S SP+R + P+ Sbjct: 485 LSPSRSRSLTRSRSHSPSPS--QSRSRSRSRSQSPSPSPAREKLTRPA 530
>CWC22_MAGGR (Q52B63) Pre-mRNA-splicing factor CWC22| Length = 907 Score = 36.6 bits (83), Expect = 0.015 Identities = 21/54 (38%), Positives = 33/54 (61%) Frame = +2 Query: 176 NPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQXQ 337 +PS+S ++ +RS+SP P R ++ + S SR +SRS S S +S +P Q Q Sbjct: 704 SPSRSVSRSISRSRSPAPIRGRSYSRSVSRSRSRSYSRSVSRSPTPPRRQAPAQ 757 Score = 29.3 bits (64), Expect = 2.4 Identities = 18/46 (39%), Positives = 30/46 (65%), Gaps = 1/46 (2%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPS-RCQSQSPS 316 S+SR ++ +RS S +P+ + P+Q R + RS +PS R +S+S S Sbjct: 732 SRSRSRSYSRSVSRSPTPPRRQAPAQQRGRQRSYTPSDRSRSRSYS 777 Score = 28.1 bits (61), Expect = 5.4 Identities = 15/42 (35%), Positives = 25/42 (59%) Frame = +2 Query: 191 RCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 R + +RS+S P R + + +R SRS+S S +S+SP+ Sbjct: 679 RSYSRSRSRSVTPRRTNSNGRNNARSPSRSVSRSISRSRSPA 720
>CWC21_USTMA (Q4P0G6) Pre-mRNA-splicing factor CWC21| Length = 348 Score = 35.8 bits (81), Expect = 0.026 Identities = 21/48 (43%), Positives = 32/48 (66%), Gaps = 3/48 (6%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRC---QSQSPS 316 S+SR ++ +RS+S + S + S+SR SRS SPSRC +S+SP+ Sbjct: 277 SRSRSRSRSRSRSRSRSPLSHSRSSRSRSPSRSRSPSRCASSRSRSPA 324 Score = 27.7 bits (60), Expect = 7.0 Identities = 18/43 (41%), Positives = 26/43 (60%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQS 310 S SR + +RS+S + SR ++ +P SRS SPSR +S S Sbjct: 272 SHSR-SSRSRSRSRSRSRSRSRSPLSHSRSSRSRSPSRSRSPS 313 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/36 (44%), Positives = 23/36 (63%) Frame = +2 Query: 206 NRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 313 +RS+S + SR + SR +SRS S SR +S+SP Sbjct: 259 SRSRSRSRSRSPLSHSRSSRSRSRSRSRSRSRSRSP 294
>SFRS6_HUMAN (Q13247) Splicing factor, arginine/serine-rich 6 (Pre-mRNA-splicing| factor SRP55) Length = 344 Score = 34.7 bits (78), Expect = 0.058 Identities = 20/48 (41%), Positives = 31/48 (64%), Gaps = 3/48 (6%) Frame = +2 Query: 182 SQSRCQNXNRSQSP---NPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 S+SR ++ +RS SP PS+ ++++P R SRS S SR +S+S S Sbjct: 291 SKSRSRSQSRSNSPLPVPPSKARSVSPPPKRATSRSRSRSRSKSRSRS 338
>PDE4A_DROME (Q9W4T4) cAMP-specific 3',5'-cyclic phosphodiesterase, isoform I| (EC 3.1.4.17) (Learning/memory process protein) (Protein dunce) Length = 1209 Score = 34.7 bits (78), Expect = 0.058 Identities = 19/50 (38%), Positives = 27/50 (54%), Gaps = 2/50 (4%) Frame = +2 Query: 176 NPSQSRCQNXNRSQSPNPSRCQNLNPSQS--RCQSRSLSPSRCQSQSPSL 319 NP QS QN ++ +PNP++ N NP+Q+ RC CQ Q+ L Sbjct: 284 NPCQSAVQNQGQNSNPNPNQNPNTNPNQNQQRCS--------CQPQTSPL 325
>CWC22_YARLI (Q6C8C5) Pre-mRNA-splicing factor CWC22| Length = 954 Score = 34.7 bits (78), Expect = 0.058 Identities = 19/45 (42%), Positives = 29/45 (64%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 S+SR ++ +R ++ +P R + + S SR SRS S SR S+SPS Sbjct: 830 SRSRSRSLSRDRTGSPPRGRRRSRSYSRSPSRSYSRSRSYSRSPS 874
>H6ST2_MOUSE (Q80UW0) Heparan-sulfate 6-O-sulfotransferase 2 (EC 2.8.2.-)| (HS6ST-2) (mHS6ST-2) (Fragment) Length = 538 Score = 34.3 bits (77), Expect = 0.075 Identities = 17/47 (36%), Positives = 30/47 (63%) Frame = +2 Query: 185 QSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQ 325 QS+ Q ++SQSP + QN NP+ ++ +++LS + S +P+ TQ Sbjct: 457 QSQSQGQSQSQSPGQNLSQNPNPNPNQNLTQNLSHNLTPSSNPNSTQ 503 Score = 30.8 bits (68), Expect = 0.83 Identities = 16/43 (37%), Positives = 25/43 (58%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQS 310 SQS+ N SQ+PNP+ QNL + S + S +P+ Q ++ Sbjct: 464 SQSQSPGQNLSQNPNPNPNQNLTQNLSHNLTPSSNPNSTQREN 506
>CCNL2_XENTR (Q5BKF8) Cyclin-L2| Length = 497 Score = 34.3 bits (77), Expect = 0.075 Identities = 19/43 (44%), Positives = 27/43 (62%) Frame = +2 Query: 185 QSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 313 QS ++ +RSQSP + Q+ +PS S+S SPSR +S SP Sbjct: 370 QSYSRSQSRSQSPKRRKSQSYSPSS---DSKSRSPSRSRSDSP 409 Score = 29.3 bits (64), Expect = 2.4 Identities = 21/47 (44%), Positives = 25/47 (53%) Frame = +2 Query: 176 NPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 +P R S+S + SR Q S SR QSRS SP R +SQS S Sbjct: 349 SPVNGRVSKGRDSRSGSRSRDQ----SYSRSQSRSQSPKRRKSQSYS 391
>RSP3_CAEEL (Q9NEW6) Probable splicing factor, arginine/serine-rich 3 (CeSF2)| (CeSF2/ASF) Length = 258 Score = 33.9 bits (76), Expect = 0.098 Identities = 20/45 (44%), Positives = 27/45 (60%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 S+SR R SP S ++ + S+SR +SRS S SR S+SPS Sbjct: 212 SRSRSPRAERRASPKYSPRRSRSRSRSRSRSRSRSASRSPSRSPS 256 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/40 (40%), Positives = 24/40 (60%) Frame = +2 Query: 197 QNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 ++ +RS+SP R + S R +SRS S SR +S+S S Sbjct: 209 RDRSRSRSPRAERRASPKYSPRRSRSRSRSRSRSRSRSAS 248
>SFRS4_MOUSE (Q8VE97) Splicing factor, arginine/serine-rich 4| Length = 489 Score = 33.9 bits (76), Expect = 0.098 Identities = 18/48 (37%), Positives = 32/48 (66%), Gaps = 1/48 (2%) Frame = +2 Query: 176 NPS-QSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 NP ++R ++ ++S+ P+ ++ + S S+ +SRS SPSR S+SPS Sbjct: 432 NPEPRARSRSTSKSKPNVPAESRSRSKSASKTRSRSKSPSRSASRSPS 479 Score = 30.8 bits (68), Expect = 0.83 Identities = 15/35 (42%), Positives = 24/35 (68%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLS 286 S+S+ + RS+S +PSR + +PS+SR +S S S Sbjct: 455 SRSKSASKTRSRSKSPSRSASRSPSRSRSRSHSRS 489
>SFRS5_HUMAN (Q13243) Splicing factor, arginine/serine-rich 5 (Pre-mRNA-splicing| factor SRP40) (Delayed-early protein HRS) Length = 272 Score = 32.7 bits (73), Expect = 0.22 Identities = 20/45 (44%), Positives = 32/45 (71%), Gaps = 1/45 (2%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQ-NLNPSQSRCQSRSLSPSRCQSQSP 313 S+SR ++ +RS+S + SR + + + S+SR +SRS S SR S+SP Sbjct: 190 SRSRTRSSSRSRSRSRSRSRKSYSRSRSRSRSRSRSKSRSVSRSP 234
>RSP1_CAEEL (Q23121) Probable splicing factor, arginine/serine-rich 1| (RNA-binding protein srp-5) (CeSRp75) Length = 312 Score = 32.7 bits (73), Expect = 0.22 Identities = 19/45 (42%), Positives = 30/45 (66%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 S+S ++ +RS+SP P R + + S+SR +SRS S +S+SPS Sbjct: 228 SRSSSRSKSRSRSP-PKRSRRESKSKSRSRSRSRSADNRKSRSPS 271 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = +2 Query: 206 NRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 313 +RS+S + SR ++ + + R +SRS S S+ +S+SP Sbjct: 206 SRSRSNSRSRSRSRSRDRRRSRSRSSSRSKSRSRSP 241
>SFRS5_RAT (Q09167) Splicing factor, arginine/serine-rich 5 (Pre-mRNA-splicing| factor SRP40) (Insulin-induced growth response protein CL-4) (Delayed-early protein HRS) Length = 269 Score = 32.3 bits (72), Expect = 0.29 Identities = 20/44 (45%), Positives = 32/44 (72%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 313 S+SR ++ +RS+S + SR ++ + S+SR +SRS S SR S+SP Sbjct: 189 SRSRTRSSSRSRSRSRSR-RSKSYSRSRSRSRSRSKSRSGSRSP 231
>SFRS4_HUMAN (Q08170) Splicing factor, arginine/serine-rich 4 (Pre-mRNA-splicing| factor SRP75) (SRP001LB) Length = 494 Score = 32.3 bits (72), Expect = 0.29 Identities = 17/45 (37%), Positives = 30/45 (66%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 ++SR ++ ++S+ PS ++ + S S+ +SRS S SR S+SPS Sbjct: 440 TRSRSRSNSKSKPNLPSESRSRSKSASKTRSRSKSRSRSASRSPS 484 Score = 30.8 bits (68), Expect = 0.83 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 S+SR +RS+S + + + S+SR SRS S SR +SQS S Sbjct: 196 SRSRHSRKSRSRSGSSKSSHSKSRSRSRSGSRSRSKSRSRSQSRS 240 Score = 27.7 bits (60), Expect = 7.0 Identities = 20/46 (43%), Positives = 29/46 (63%) Frame = +2 Query: 179 PSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 PS+SR RS+S + +R + S+SR +S S SPSR +S+S S Sbjct: 455 PSESRS----RSKSASKTRSR----SKSRSRSASRSPSRSRSRSHS 492
>UAFA_STAS1 (Q4A0V8) Uro-adherence factor A precursor| Length = 2316 Score = 32.3 bits (72), Expect = 0.29 Identities = 20/53 (37%), Positives = 33/53 (62%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQ 331 L+ S+S Q+ + SQS + S ++L+ S+S +S SLS S S S SL++ + Sbjct: 1723 LSTSESLRQSESLSQSLSLSASESLSASESISESESLSESESLSASESLSESE 1775 Score = 31.2 bits (69), Expect = 0.64 Identities = 17/53 (32%), Positives = 33/53 (62%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQ 331 L+ S+S ++ + S+S + S ++L+ S+S +S SLS SQS +L++ + Sbjct: 1303 LSESESLSESESLSESESLSASESLSESESLSESESLSARESLSQSEALSESE 1355 Score = 29.6 bits (65), Expect = 1.9 Identities = 20/47 (42%), Positives = 28/47 (59%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLT 322 S S ++ + SQS + S +L+ S+S QS SLS S SQS SL+ Sbjct: 814 SLSLSESLSTSQSLSLSHSLSLSESESTSQSLSLSTSESLSQSLSLS 860 Score = 29.3 bits (64), Expect = 2.4 Identities = 18/53 (33%), Positives = 30/53 (56%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQ 331 L+ S+S + SQS S ++L+ S+S +S SLS S S+S L++ + Sbjct: 1333 LSESESLSARESLSQSEALSESESLSTSESLSESESLSASESISESEYLSESE 1385 Score = 29.3 bits (64), Expect = 2.4 Identities = 19/53 (35%), Positives = 31/53 (58%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQ 331 L+ S S ++ + SQS + S ++L+ S S S SLS S S+S SL++ + Sbjct: 829 LSHSLSLSESESTSQSLSLSTSESLSQSLSLSASESLSESESLSESESLSESE 881 Score = 28.1 bits (61), Expect = 5.4 Identities = 18/50 (36%), Positives = 29/50 (58%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQ 331 S S + + SQS + S ++L+ S+S +S SLS S S S SL++ + Sbjct: 844 SLSLSTSESLSQSLSLSASESLSESESLSESESLSESESLSASESLSESE 893
>SFR16_MOUSE (Q8CFC7) Splicing factor, arginine/serine-rich 16 (Suppressor of| white-apricot homolog 2) (Clk4-associating SR-related protein) Length = 653 Score = 32.0 bits (71), Expect = 0.37 Identities = 19/46 (41%), Positives = 25/46 (54%) Frame = +2 Query: 179 PSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 P + S S +PSR +++ S SR QSRS S S+ SQS S Sbjct: 465 PRHHSSSHSRSSWSLSPSRSRSVTRSGSRSQSRSRSRSQSHSQSQS 510 Score = 29.3 bits (64), Expect = 2.4 Identities = 19/48 (39%), Positives = 29/48 (60%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 L+PS+SR + RS S + SR ++ + S S+ QS S SP R + P+ Sbjct: 479 LSPSRSR--SVTRSGSRSQSRSRSRSQSHSQSQSHSPSPPREKLTRPA 524 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +2 Query: 212 SQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 S SP+ SR + S+S+ +SRS S S QSQS S Sbjct: 478 SLSPSRSRSVTRSGSRSQSRSRSRSQSHSQSQSHS 512
>SRBS1_MOUSE (Q62417) Sorbin and SH3 domain-containing protein 1 (Ponsin)| (c-Cbl-associated protein) (CAP) (SH3 domain protein 5) (SH3P12) Length = 1290 Score = 31.6 bits (70), Expect = 0.49 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 218 SPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQXQ 337 S +PSR ++P Q + Q R ++P R Q PSL C Q Sbjct: 1199 SSSPSRSATVSPQQPQAQQRRVTPDRSQ---PSLDLCSYQ 1235
>SYNJ1_HUMAN (O43426) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) Length = 1575 Score = 31.6 bits (70), Expect = 0.49 Identities = 18/53 (33%), Positives = 24/53 (45%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQ 331 L PS S + S SP S CQ+ S+ S + PSR S++P Q Sbjct: 1030 LQPSSSSGLGTSPSSSPRTSPCQSPTISEGPVPSLPIRPSRAPSRTPGPPSAQ 1082
>SFRS2_CHICK (P30352) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) Length = 221 Score = 31.2 bits (69), Expect = 0.64 Identities = 19/47 (40%), Positives = 30/47 (63%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLT 322 S+SR ++ +RS S + S ++ + S S +SRS S SR +S+SP T Sbjct: 149 SRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSPPPT 195
>VE2_HPV17 (P36785) Regulatory protein E2| Length = 452 Score = 30.8 bits (68), Expect = 0.83 Identities = 18/44 (40%), Positives = 26/44 (59%) Frame = +2 Query: 185 QSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 + R + + S+SPN R + +R QSRSLS SR +S+S S Sbjct: 287 RERSYSRDSSRSPNRGRGGSSGGPTTRSQSRSLSRSRSRSRSRS 330
>SFRS5_MOUSE (O35326) Splicing factor, arginine/serine-rich 5 (Pre-mRNA-splicing| factor SRP40) (Delayed-early protein HRS) Length = 270 Score = 30.8 bits (68), Expect = 0.83 Identities = 20/44 (45%), Positives = 31/44 (70%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 313 S+SR ++ RS+S + SR ++ + S+SR +SRS S SR S+SP Sbjct: 190 SRSRTRSSLRSRSRSRSR-RSKSYSRSRSRSRSRSKSRSGSRSP 232
>SFRS2_RAT (Q6PDU1) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) Length = 220 Score = 30.8 bits (68), Expect = 0.83 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 313 S+SR ++ +RS S + S ++ + S S +SRS S SR +S+SP Sbjct: 148 SRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSP 191
>SFRS2_PANTR (Q5R1W5) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) Length = 220 Score = 30.8 bits (68), Expect = 0.83 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 313 S+SR ++ +RS S + S ++ + S S +SRS S SR +S+SP Sbjct: 148 SRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSP 191
>SFRS2_MOUSE (Q62093) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) (Putative myelin regulatory factor 1) (MRF-1) Length = 220 Score = 30.8 bits (68), Expect = 0.83 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 313 S+SR ++ +RS S + S ++ + S S +SRS S SR +S+SP Sbjct: 148 SRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSP 191
>SFRS2_HUMAN (Q01130) Splicing factor, arginine/serine-rich 2 (Splicing factor| SC35) (SC-35) (Splicing component, 35 kDa) (PR264 protein) Length = 220 Score = 30.8 bits (68), Expect = 0.83 Identities = 18/44 (40%), Positives = 29/44 (65%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 313 S+SR ++ +RS S + S ++ + S S +SRS S SR +S+SP Sbjct: 148 SRSRTRSRSRSTSKSRSARRSKSKSSSVSRSRSRSRSRSRSRSP 191
>NCAP_CVCAE (Q04700) Nucleocapsid protein (N structural protein) (NC)| Length = 382 Score = 30.4 bits (67), Expect = 1.1 Identities = 16/29 (55%), Positives = 20/29 (68%) Frame = +2 Query: 224 NPSRCQNLNPSQSRCQSRSLSPSRCQSQS 310 N SR + +PSQSR QSR+ S SR + QS Sbjct: 154 NQSRDNSRSPSQSRSQSRNRSQSRGRQQS 182 Score = 27.3 bits (59), Expect = 9.2 Identities = 13/28 (46%), Positives = 20/28 (71%) Frame = +2 Query: 197 QNXNRSQSPNPSRCQNLNPSQSRCQSRS 280 Q+ + S+SP+ SR Q+ N SQSR + +S Sbjct: 155 QSRDNSRSPSQSRSQSRNRSQSRGRQQS 182
>CWC22_ASPFU (Q4WKB9) Pre-mRNA-splicing factor cwc22| Length = 881 Score = 30.4 bits (67), Expect = 1.1 Identities = 19/49 (38%), Positives = 33/49 (67%), Gaps = 1/49 (2%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLS-PSRCQSQSPSLTQ 325 S+SR ++ + S+SP+ SR + + S+ R SRS+S SR +S +PS ++ Sbjct: 656 SRSRSRSYSYSRSPSRSRGRRRSISRGRSYSRSVSGSSRGRSYTPSYSR 704
>H6ST2_HUMAN (Q96MM7) Heparan-sulfate 6-O-sulfotransferase 2 (EC 2.8.2.-)| (HS6ST-2) Length = 605 Score = 30.4 bits (67), Expect = 1.1 Identities = 15/34 (44%), Positives = 23/34 (67%) Frame = +2 Query: 185 QSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLS 286 QS+ N N+SQ+PNP+ QNL + + ++SLS Sbjct: 537 QSQNPNQNQSQNPNPNANQNLTQNLMQNLTQSLS 570 Score = 27.7 bits (60), Expect = 7.0 Identities = 13/38 (34%), Positives = 24/38 (63%) Frame = +2 Query: 197 QNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQS 310 Q +SQ+PN ++ QN NP+ ++ +++L + QS S Sbjct: 533 QGQGQSQNPNQNQSQNPNPNANQNLTQNLMQNLTQSLS 570
>SYNJ1_RAT (Q62910) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) Length = 1574 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 313 L PS S + S SP S CQ+ + S + PSR S++P Sbjct: 1030 LQPSSSSGLGTSPSSSPRTSPCQSPTAPEYSAPSLPIRPSRAPSRTP 1076
>NKTR_HUMAN (P30414) NK-tumor recognition protein (Natural-killer cells| cyclophilin-related protein) (NK-TR protein) Length = 1462 Score = 30.0 bits (66), Expect = 1.4 Identities = 16/37 (43%), Positives = 27/37 (72%) Frame = +2 Query: 212 SQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLT 322 SQS +PSR ++ + ++SR ++RS+S S +S+S S T Sbjct: 1309 SQSRSPSRSRSKSETKSRHRTRSVSYSHSRSRSRSST 1345
>SYNJ1_MOUSE (Q8CHC4) Synaptojanin-1 (EC 3.1.3.36) (Synaptic| inositol-1,4,5-trisphosphate 5-phosphatase 1) Length = 1574 Score = 29.6 bits (65), Expect = 1.9 Identities = 16/47 (34%), Positives = 22/47 (46%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 313 L PS S + S SP S CQ+ + S + PSR S++P Sbjct: 1030 LQPSSSSGLGTSPSSSPRTSPCQSPTVPEYSAPSLPIRPSRAPSRTP 1076
>A36DE_DROME (Q9V3R1) Accessory gland protein Acp36DE precursor| Length = 912 Score = 29.6 bits (65), Expect = 1.9 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 8/60 (13%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNL--------NPSQSRCQSRSLSPSRCQSQSPSLTQCQXQ 337 SQ++ Q+ ++S+S S+ Q NP S QS+S S S+ +SQ S +Q Q Q Sbjct: 196 SQTQSQSASQSESNASSQFQAQEQSNRLLENPPVSESQSQSESQSQSESQKQSQSQSQRQ 255 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/52 (32%), Positives = 25/52 (48%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQXQ 337 SQ + Q + NP ++ + S+S+ QS S S+ QSQ Q Q Q Sbjct: 212 SQFQAQEQSNRLLENPPVSESQSQSESQSQSESQKQSQSQSQRQQQIQTQLQ 263
>VE2_HPV25 (P36787) Regulatory protein E2| Length = 502 Score = 29.3 bits (64), Expect = 2.4 Identities = 19/38 (50%), Positives = 25/38 (65%) Frame = +2 Query: 197 QNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQS 310 Q +RS+S + SR Q S+SR +SRS S SR +SQS Sbjct: 264 QRRSRSKSRSRSRSQ----SRSRIRSRSRSRSRSESQS 297
>PRP45_CANAL (Q5AC37) Pre-mRNA-splicing factor PRP45 (Pre-mRNA-processing| protein 45) Length = 286 Score = 29.3 bits (64), Expect = 2.4 Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 2/43 (4%) Frame = +2 Query: 173 LNPSQSRCQNXN--RSQSPNPSRCQNLNPSQSRCQSRSLSPSR 295 LNPS + N + ++PNP+ N NP+Q + Q S S S+ Sbjct: 104 LNPSDEPTNDINYIKYENPNPNPNPNPNPNQEQQQQSSSSSSK 146
>CWC21_NEUCR (Q7RYH7) Pre-mRNA-splicing factor cwc-21| Length = 344 Score = 29.3 bits (64), Expect = 2.4 Identities = 19/55 (34%), Positives = 31/55 (56%), Gaps = 3/55 (5%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSR---CQSQSPSLTQCQXQ 337 ++S ++ RS+SP R + + S+SR SRS SP R SQ SL++ + + Sbjct: 268 TRSPVRDTGRSRSPVSERSLSRSRSRSRSYSRSRSPPRRRAADSQDRSLSRSRSR 322
>DTBP1_HUMAN (Q96EV8) Dystrobrevin-binding protein 1 (Dysbindin)| (Hermansky-Pudlak syndrome 7 protein) Length = 351 Score = 28.9 bits (63), Expect = 3.2 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQS 262 L P S CQN Q PNPS + PS S Sbjct: 270 LGPESSTCQNEITLQVPNPSELRAKPPSSS 299
>VE2_HPV21 (P50767) Regulatory protein E2| Length = 503 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/39 (43%), Positives = 25/39 (64%) Frame = +2 Query: 209 RSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQ 325 RS+S + SR ++ + +SR +SRS S SR +SQS Q Sbjct: 266 RSRSKSRSRSRSRSRLRSRSRSRSRSYSRSRSQSSDQPQ 304
>RSP4_CAEEL (Q09511) Probable splicing factor, arginine/serine-rich 4| (RNA-binding protein srp-2) (CeSC35) Length = 196 Score = 28.5 bits (62), Expect = 4.1 Identities = 16/40 (40%), Positives = 23/40 (57%) Frame = +2 Query: 191 RCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQS 310 R + +RS+SP P + +SR +S S SPSR +S S Sbjct: 156 RDNSRSRSRSPPPREDGSPKERRSRSRSASRSPSRSRSNS 195
>NO20_MEDTR (P93329) Early nodulin 20 precursor (N-20)| Length = 268 Score = 28.1 bits (61), Expect = 5.4 Identities = 16/47 (34%), Positives = 24/47 (51%) Frame = +2 Query: 176 NPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 +PS S + + P+P + +PS S S+S SPS S +PS Sbjct: 170 SPSPSPSPSPRSTPIPHPRKRSPASPSPSPSLSKSPSPSESPSLAPS 216
>K10_DROME (P13468) DNA-binding protein K10 (Female sterile protein K10)| Length = 463 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/47 (29%), Positives = 29/47 (61%), Gaps = 1/47 (2%) Frame = +2 Query: 176 NPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRC-QSQSP 313 +P+Q + + N+ Q PN ++ Q+L+P+Q + + + + + QSQ P Sbjct: 148 SPNQQQHPSPNQQQHPNSNQQQHLSPNQQQGKMNNQNNNHMNQSQQP 194 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/48 (29%), Positives = 30/48 (62%), Gaps = 4/48 (8%) Frame = +2 Query: 176 NPSQSRCQNXNRSQSPNPSRCQNLNPSQSR----CQSRSLSPSRCQSQ 307 +P+Q + + N+ Q P+P++ Q+ +P+Q + Q + LSP++ Q + Sbjct: 132 SPNQQQPPSPNQQQHPSPNQQQHPSPNQQQHPNSNQQQHLSPNQQQGK 179
>STP2_CANFA (O77645) Nuclear transition protein 2 (TP-2) (TP2)| Length = 129 Score = 28.1 bits (61), Expect = 5.4 Identities = 22/53 (41%), Positives = 25/53 (47%), Gaps = 6/53 (11%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSP------SRCQSQSPSLT 322 S SR Q SQ S CQ + S S+ +S S SP S QSQSP T Sbjct: 17 SNSRPQGHTCSQCTCSSHCQTCSQSCSQSRSSSQSPTGHHSSSGHQSQSPHPT 69
>SFR12_MOUSE (Q8BZX4) Splicing factor, arginine/serine-rich 12| (Serine-arginine-rich splicing regulatory protein 86) (SRrp86) Length = 494 Score = 28.1 bits (61), Expect = 5.4 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +2 Query: 176 NPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRS 280 N S+SR ++ RS+SP+ R ++ +SR +SRS Sbjct: 226 NRSRSRQKDRRRSKSPHKKRSKSRERRKSRSRSRS 260
>ATG15_DEBHA (Q6BLM0) Putative lipase ATG15 (EC 3.1.1.3) (Autophagy-related| protein 15) Length = 615 Score = 27.7 bits (60), Expect = 7.0 Identities = 20/48 (41%), Positives = 25/48 (52%), Gaps = 2/48 (4%) Frame = +2 Query: 179 PSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQS--RSLSPSRCQSQSPS 316 PS R N QSPN SR + ++ C S +S+SPS SQ PS Sbjct: 536 PSTVRSSNMPHEQSPNASRSLSSLCTEPSCTSSFQSVSPS-FSSQLPS 582
>SFRS1_ARATH (O22315) Pre-mRNA-splicing factor SF2 (SR1 protein)| Length = 303 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 4/40 (10%) Frame = +2 Query: 206 NRSQSPNPSRCQNLNPSQSRCQ----SRSLSPSRCQSQSP 313 +R S +PSR ++ + S+SR + SRS S SR +S+SP Sbjct: 197 SRKDSRSPSRGRSYSKSRSRSRGRSVSRSRSRSRSRSRSP 236
>ZN265_HUMAN (O95218) Zinc finger protein 265 (Zinc finger, splicing)| Length = 337 Score = 27.7 bits (60), Expect = 7.0 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 S R ++ +RS S + S ++ +PS SR +SRS S S SQS S Sbjct: 198 SNRRSRSKSRS-SHSRSSSRSSSPSSSRSRSRSRSRSSSSSQSRS 241
>ZN265_RAT (O35986) Zinc finger protein 265 (Zinc finger, splicing)| Length = 332 Score = 27.7 bits (60), Expect = 7.0 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 S R ++ +RS S + S ++ +PS SR +SRS S S SQS S Sbjct: 198 SNRRSRSKSRS-SHSRSSSRSSSPSSSRSRSRSRSRSSSSSQSRS 241
>PIM1_MOUSE (P06803) Proto-oncogene serine/threonine-protein kinase Pim-1 (EC| 2.7.11.1) Length = 397 Score = 27.7 bits (60), Expect = 7.0 Identities = 18/50 (36%), Positives = 28/50 (56%) Frame = +2 Query: 179 PSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQC 328 P++ + + +S S +PS + + SQSR +RSLSP R S S +C Sbjct: 21 PARGQPRQRPQSSSDSPSALR-ASRSQSRNATRSLSPGRRLSPSSLRRRC 69
>CWC22_NEUCR (Q7RX84) Pre-mRNA-splicing factor cwc-22| Length = 1010 Score = 27.7 bits (60), Expect = 7.0 Identities = 20/47 (42%), Positives = 27/47 (57%), Gaps = 8/47 (17%) Frame = +2 Query: 209 RSQSPNPSRCQNLNP-----SQSRCQS---RSLSPSRCQSQSPSLTQ 325 R+ SP+P R ++L+P S R +S RS SPSR +SPS Q Sbjct: 59 RTPSPSPRRDRSLSPRDQPHSHPRSRSPTPRSQSPSRRSVRSPSPRQ 105
>KIF2_XENLA (Q91637) Kinesin-like protein KIF2 (Kinesin-related protein XKIF2)| Length = 682 Score = 27.7 bits (60), Expect = 7.0 Identities = 14/38 (36%), Positives = 20/38 (52%), Gaps = 1/38 (2%) Frame = +2 Query: 218 SPNPSRCQN-LNPSQSRCQSRSLSPSRCQSQSPSLTQC 328 SP + C+N LN + + + L PSRC+ P T C Sbjct: 506 SPGMASCENTLNTLRYANRVKELDPSRCRRPPPHDTSC 543
>ZN265_MOUSE (Q9R020) Zinc finger protein 265 (Zinc finger, splicing) (Fragment)| Length = 326 Score = 27.7 bits (60), Expect = 7.0 Identities = 19/45 (42%), Positives = 27/45 (60%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 S R ++ +RS S + S ++ +PS SR +SRS S S SQS S Sbjct: 198 SNRRSRSKSRS-SHSRSSSRSSSPSSSRSRSRSRSRSSSSSQSRS 241
>VE2_HPV12 (P36782) Regulatory protein E2| Length = 494 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 2/50 (4%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQ--SQSPSLTQ 325 S++R Q + +S + R Q+ + S+S+ Q+R+L + S+SPS+TQ Sbjct: 250 SRTRRQETQQRRSRSRYRSQSNSRSRSQSQTRALGATSVSRSSRSPSVTQ 299
>SFRS7_HUMAN (Q16629) Splicing factor, arginine/serine-rich 7 (Splicing factor| 9G8) Length = 238 Score = 27.7 bits (60), Expect = 7.0 Identities = 17/37 (45%), Positives = 23/37 (62%), Gaps = 3/37 (8%) Frame = +2 Query: 215 QSPNPSRCQNLN---PSQSRCQSRSLSPSRCQSQSPS 316 QSP+ SR ++ + P SR +SRS SP R +S S S Sbjct: 191 QSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGS 227
>STP2_MACFA (Q8WNV1) Nuclear transition protein 2 (TP-2) (TP2)| Length = 141 Score = 27.7 bits (60), Expect = 7.0 Identities = 15/44 (34%), Positives = 26/44 (59%) Frame = +2 Query: 185 QSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 Q+ Q+ +SQ + SR + +P+ + + + S S CQSQSP+ Sbjct: 34 QTFSQSCRQSQRGSRSRSSSQSPATHQNPTGAHSSSGCQSQSPN 77
>NOL3_HUMAN (O60936) Nucleolar protein 3 (Apoptosis repressor with CARD)| (Muscle-enriched cytoplasmic protein) (Myp) (Nucleolar protein of 30 kDa) (Nop30) Length = 219 Score = 27.7 bits (60), Expect = 7.0 Identities = 16/53 (30%), Positives = 31/53 (58%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPSLTQCQ 331 L P + ++ ++SQS NP QN + + S+ +++S SP+ + SP + + Q Sbjct: 156 LRPLKRLNRSRSQSQSWNPRLKQNQSRNWSQNRTQSPSPTSRKGTSPKIPEGQ 208 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/46 (34%), Positives = 25/46 (54%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQS 310 L +QSR + NR+QSP+P+ + +P QS S RC + + Sbjct: 176 LKQNQSRNWSQNRTQSPSPTSRKGTSPKIPEGQS---SDRRCPAHA 218
>VE2_BPV6 (Q705F3) Regulatory protein E2| Length = 435 Score = 27.3 bits (59), Expect = 9.2 Identities = 18/41 (43%), Positives = 26/41 (63%), Gaps = 3/41 (7%) Frame = +2 Query: 179 PSQSRCQNXNRSQSPNP---SRCQNLNPSQSRCQSRSLSPS 292 P SR ++ + S S + SR Q+L+ S+SR +SRS SPS Sbjct: 231 PVTSRRRHSSSSDSHSSRRGSRPQSLSRSRSRSRSRSRSPS 271
>TOLA_ECOLI (P19934) Protein tolA| Length = 421 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/31 (51%), Positives = 19/31 (61%) Frame = +3 Query: 150 QARADAKT*TQARADAKTXTEARAQTRADAK 242 +A ADAK +A ADAK EA + ADAK Sbjct: 140 KAAADAKA--KAEADAKAAEEAAKKAAADAK 168
>RBBP6_MOUSE (P97868) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) Length = 1790 Score = 27.3 bits (59), Expect = 9.2 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +2 Query: 179 PSQSRCQNXN---RSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 P + R ++ N RS+S R ++ +P R SRS SP + QSP+ Sbjct: 735 PRRGRGKSRNYRSRSRSHGYHRSRSRSPPYRRYHSRSRSPQAFRGQSPT 783
>RBBP6_HUMAN (Q7Z6E9) Retinoblastoma-binding protein 6 (p53-associated cellular| protein of testis) (Proliferation potential-related protein) (Protein P2P-R) (Retinoblastoma-binding Q protein 1) (Protein RBQ-1) Length = 1792 Score = 27.3 bits (59), Expect = 9.2 Identities = 17/49 (34%), Positives = 26/49 (53%), Gaps = 3/49 (6%) Frame = +2 Query: 179 PSQSRCQNXN---RSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 P + R ++ N RS+S R ++ +P R SRS SP + QSP+ Sbjct: 734 PRRGRGKSRNYRSRSRSHGYHRSRSRSPPYRRYHSRSRSPQAFRGQSPN 782
>YL041_MIMIV (Q5UPC0) Hypothetical protein L41| Length = 478 Score = 27.3 bits (59), Expect = 9.2 Identities = 16/44 (36%), Positives = 25/44 (56%) Frame = +2 Query: 182 SQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSP 313 SQ + + R +S + SR + S+ + RS SPSR +S+SP Sbjct: 142 SQIKYRPVERQKSSDRSRSSSRKRSRLPLRERSRSPSRERSRSP 185
>SFRS7_MOUSE (Q8BL97) Splicing factor, arginine/serine-rich 7| Length = 267 Score = 27.3 bits (59), Expect = 9.2 Identities = 18/44 (40%), Positives = 25/44 (56%) Frame = +2 Query: 185 QSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQSPS 316 QSR ++ +RS+S + P SR +SRS SP R +S S S Sbjct: 220 QSRSRSRSRSRSIS-------RPRSSRSKSRSPSPKRSRSPSGS 256
>LBR_RAT (O08984) Lamin-B receptor (Integral nuclear envelope inner membrane| protein) (NBP60) Length = 620 Score = 27.3 bits (59), Expect = 9.2 Identities = 18/46 (39%), Positives = 26/46 (56%) Frame = +2 Query: 173 LNPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRSLSPSRCQSQS 310 + P +S Q + S S +PSR ++ S+SR +SRS SP R S Sbjct: 54 IKPLKSFKQRKSGSTSSSPSRRRS---SRSRSRSRSRSPGRAPKGS 96
>SFR12_RAT (Q9JKL7) Splicing factor, arginine/serine-rich 12| (Serine-arginine-rich splicing regulatory protein 86) (SRrp86) (SR-related protein of 86 kDa) Length = 494 Score = 27.3 bits (59), Expect = 9.2 Identities = 14/35 (40%), Positives = 23/35 (65%) Frame = +2 Query: 176 NPSQSRCQNXNRSQSPNPSRCQNLNPSQSRCQSRS 280 N S+SR ++ RS+SP+ R ++ +SR +SRS Sbjct: 226 NRSRSRQKDRARSKSPHKKRSKSRERRKSRSRSRS 260 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.309 0.134 0.454 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,067,556 Number of Sequences: 219361 Number of extensions: 130822 Number of successful extensions: 1269 Number of sequences better than 10.0: 62 Number of HSP's better than 10.0 without gapping: 756 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1199 length of database: 80,573,946 effective HSP length: 101 effective length of database: 58,418,485 effective search space used: 1402043640 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.6 bits)
