| Clone Name | bags25o11 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GUC2C_RAT (P23897) Heat-stable enterotoxin receptor precursor (G... | 31 | 3.0 | 2 | DNM3A_MOUSE (O88508) DNA (cytosine-5)-methyltransferase 3A (EC 2... | 30 | 5.1 | 3 | POU23_BRARE (P79745) POU domain protein ZP-23 | 30 | 5.1 | 4 | FRQ_LEPAU (Q01115) Frequency clock protein | 30 | 6.7 | 5 | L_PI2HT (P26676) Large structural protein (Protein L) (Transcrip... | 30 | 6.7 |
|---|
>GUC2C_RAT (P23897) Heat-stable enterotoxin receptor precursor (GC-C)| (Intestinal guanylate cyclase) (EC 4.6.1.2) (STA receptor) Length = 1072 Score = 31.2 bits (69), Expect = 3.0 Identities = 13/33 (39%), Positives = 22/33 (66%) Frame = +3 Query: 516 IGIRLILFTPTACFVSSRITKLCLVGKYQIILL 614 + +RL+LF PT F +S++ + C G Y+I +L Sbjct: 7 LAVRLLLFQPTLMFWASQVRQKCHNGTYEISVL 39
>DNM3A_MOUSE (O88508) DNA (cytosine-5)-methyltransferase 3A (EC 2.1.1.37)| (Dnmt3a) (DNA methyltransferase MmuIIIA) (DNA MTase MmuIIIA) (M.MmuIIIA) Length = 908 Score = 30.4 bits (67), Expect = 5.1 Identities = 18/46 (39%), Positives = 25/46 (54%) Frame = -1 Query: 458 PGTRSVSTLEADEDREKDGSAENQCQNGGHRVRQRYSAAVLGIMRP 321 PG S S+LE ++DR++ E Q +N G RQ SA + RP Sbjct: 6 PGDTSSSSLEREDDRKE---GEEQEENRGKEERQEPSATARKVGRP 48
>POU23_BRARE (P79745) POU domain protein ZP-23| Length = 443 Score = 30.4 bits (67), Expect = 5.1 Identities = 13/23 (56%), Positives = 14/23 (60%) Frame = +2 Query: 359 AGPCDLRSGTGFQHYHPSLGPHQ 427 +G DL SGT H P LGPHQ Sbjct: 122 SGRDDLHSGTALHHRAPHLGPHQ 144
>FRQ_LEPAU (Q01115) Frequency clock protein| Length = 992 Score = 30.0 bits (66), Expect = 6.7 Identities = 20/69 (28%), Positives = 32/69 (46%) Frame = -1 Query: 620 PV*QDNLVLAD*T*LGNSRTYEARSRRKQYQSDTDKRWANNF*NCNTTQILAVPPGTRSV 441 P + ++ AD SR E+ S Q Q+++ + AN+ NT+ +A PP R Sbjct: 364 PAREARILPADNMKKSRSRDNESTSNSNQDQTESGGKTANSGSGSNTSPPIAPPPEQRPT 423 Query: 440 STLEADEDR 414 L+ D R Sbjct: 424 RPLDLDPHR 432
>L_PI2HT (P26676) Large structural protein (Protein L) (Transcriptase)| (Replicase) [Includes: RNA-directed RNA polymerase (EC 2.7.7.48); mRNA (guanine-N(7)-)-methyltransferase (EC 2.1.1.56); mRNA guanylyltransferase (EC 2.7.7.-)] Length = 2262 Score = 30.0 bits (66), Expect = 6.7 Identities = 15/40 (37%), Positives = 21/40 (52%) Frame = +3 Query: 537 FTPTACFVSSRITKLCLVGKYQIILLHRKIHVCTPSNRQY 656 F +ACF+++ + K CL +YQ I IH NR Y Sbjct: 658 FELSACFITTDLAKYCLQWRYQTI-----IHFARTLNRMY 692 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,561,593 Number of Sequences: 219361 Number of extensions: 1748799 Number of successful extensions: 5101 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4930 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5101 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6598423128 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)