| Clone Name | bags26a18 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CI039_HUMAN (Q9NXG0) Protein C9orf39 | 30 | 4.6 | 2 | DPOG_NEUCR (Q9Y767) DNA polymerase gamma (EC 2.7.7.7) (Mitochond... | 30 | 6.0 | 3 | RBP2_BOVIN (P48820) Ran-binding protein 2 (RanBP2) (Nuclear pore... | 29 | 7.8 |
|---|
>CI039_HUMAN (Q9NXG0) Protein C9orf39| Length = 1084 Score = 30.0 bits (66), Expect = 4.6 Identities = 20/78 (25%), Positives = 35/78 (44%) Frame = -2 Query: 426 TQLQDREIIIQRGNLKRNLTISIELSAKTPTEPQQNPDCLQQLNCRPSLLQNSQAVMSPY 247 T LQD+ + ++ N K + A P + +PD Q+ RPSL ++S Sbjct: 85 TNLQDQLLQKEQENAKLKEKLQESQGAPLPLPQESDPDYSAQVPHRPSLSSLETLMVSQK 144 Query: 246 SQLNRQKNQQPFATAKLA 193 S++ + + A KL+ Sbjct: 145 SEIEYLQEKLKIANEKLS 162
>DPOG_NEUCR (Q9Y767) DNA polymerase gamma (EC 2.7.7.7) (Mitochondrial DNA| polymerase catalytic subunit) Length = 1305 Score = 29.6 bits (65), Expect = 6.0 Identities = 20/72 (27%), Positives = 31/72 (43%) Frame = +2 Query: 29 SPKLLPTVDNAENDSGNAQESQKPEVTGEEKSAAEDNVVAAAVTGVAPKDANPTAASLAV 208 SP VD A+ + + + K E GE + +D V+AA + V+ A+ A Sbjct: 1232 SPSSSSNVD-AKKTTSKTKPTHKKETEGEPFPSLDDPVIAARLEAVSKTSPGTRASVAAK 1290 Query: 209 ANGC*FFCLLSC 244 + FC SC Sbjct: 1291 LDALASFCHASC 1302
>RBP2_BOVIN (P48820) Ran-binding protein 2 (RanBP2) (Nuclear pore complex| protein Nup358) (Nucleoporin Nup358) (358 kDa nucleoporin) (P270) (Fragment) Length = 1085 Score = 29.3 bits (64), Expect = 7.8 Identities = 18/69 (26%), Positives = 32/69 (46%), Gaps = 5/69 (7%) Frame = +2 Query: 11 QLKKITSPKLLPTV-----DNAENDSGNAQESQKPEVTGEEKSAAEDNVVAAAVTGVAPK 175 +L K + KL PT + + D+GNA++ Q +E ++D +A++ G+ Sbjct: 588 ELAKADTLKLPPTFFCGICSDTDEDNGNAEDFQSELQKVQEAQKSQDENIASSADGMCTD 647 Query: 176 DANPTAASL 202 D T L Sbjct: 648 DTKVTVPFL 656 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,307,511 Number of Sequences: 219361 Number of extensions: 1022942 Number of successful extensions: 4247 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 4128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4244 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 4528412720 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)