| Clone Name | bags25k06 |
|---|---|
| Clone Library Name | barley_pub |
>SYR_PYRFU (Q8U149) Arginyl-tRNA synthetase (EC 6.1.1.19) (Arginine--tRNA| ligase) (ArgRS) Length = 629 Score = 31.2 bits (69), Expect = 0.68 Identities = 13/40 (32%), Positives = 23/40 (57%) Frame = -1 Query: 259 ENKPTCQTLALXYLEINQLLEPKLETKNQDKKIWKKKRER 140 +N P L L Y+E+N+ +E E + + +++ KK ER Sbjct: 199 KNNPIDHVLGLLYVEVNKKIEESSEVEKEIRELMKKLEER 238
>HSP79_YEAST (P32590) Heat shock protein homolog SSE2| Length = 692 Score = 30.4 bits (67), Expect = 1.2 Identities = 17/44 (38%), Positives = 26/44 (59%) Frame = -1 Query: 247 TCQTLALXYLEINQLLEPKLETKNQDKKIWKKKRERCERTNLLD 116 T +T AL +E+N L+E + E +NQDK + E +R N L+ Sbjct: 535 TAKTFALNPVELNDLIEKENELRNQDKLV----AETEDRKNALE 574
>RIR1_EHV4 (P50642) Ribonucleoside-diphosphate reductase large chain (EC| 1.17.4.1) (Ribonucleotide reductase) Length = 789 Score = 28.5 bits (62), Expect = 4.4 Identities = 11/37 (29%), Positives = 19/37 (51%) Frame = -1 Query: 253 KPTCQTLALXYLEINQLLEPKLETKNQDKKIWKKKRE 143 KP C+ Y+ +L+ +++ +N D K W K E Sbjct: 59 KPLCRVDERLYIACGELVHLRIKARNTDLKYWLKSSE 95
>Y3284_CLOAB (Q97E32) Hypothetical UPF0230 protein CAC3284| Length = 285 Score = 28.1 bits (61), Expect = 5.8 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -1 Query: 73 GMDGILVHHISCYGQ 29 GM GI VHHI+CY + Sbjct: 226 GMGGIAVHHINCYDE 240
>NCAP_IBVSA (Q8JMI6) Nucleocapsid protein (N structural protein) (NC)| Length = 409 Score = 28.1 bits (61), Expect = 5.8 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -3 Query: 305 TPPPQNEPRPTSLRGREQTHMSNTCLTXPRN*STPRTKT*NQKPRQKNMEKEER 144 T P +EP+P S R+ S P T+T + PRQ+ ++KE+R Sbjct: 329 TRPKDDEPKPKS-----------------RSSSRPATRTSSPAPRQQRLKKEKR 365
>NCAP_IBVG (P32923) Nucleocapsid protein (N structural protein) (NC)| Length = 409 Score = 28.1 bits (61), Expect = 5.8 Identities = 17/54 (31%), Positives = 26/54 (48%) Frame = -3 Query: 305 TPPPQNEPRPTSLRGREQTHMSNTCLTXPRN*STPRTKT*NQKPRQKNMEKEER 144 T P +EP+P S R+ S P T+T + PRQ+ ++KE+R Sbjct: 329 TRPKDDEPKPKS-----------------RSSSRPATRTSSPAPRQQRLKKEKR 365
>RL24_ONYPE (P60743) 50S ribosomal protein L24| Length = 79 Score = 27.3 bits (59), Expect = 9.8 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -3 Query: 317 KLDHTPPPQNEPRPTSLRGREQTHMSNTCLTXPR 216 K + PP QNE + T ++ H+SN L P+ Sbjct: 15 KPNTNPPSQNEEKGTIVKQEAPIHVSNVALVCPQ 48
>AP23_ARATH (P42736) AP2 domain transcription factor RAP2.3 (Related to AP2| protein 3) (Cadmium-induced protein AS30) Length = 248 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/29 (37%), Positives = 14/29 (48%) Frame = -3 Query: 314 LDHTPPPQNEPRPTSLRGREQTHMSNTCL 228 L H PPP P P+S R +Q C+ Sbjct: 137 LHHPPPPNYTPPPSSPRSTDQPPAKKVCV 165
>US02_HHV2H (P13292) Protein US2| Length = 290 Score = 27.3 bits (59), Expect = 9.8 Identities = 15/46 (32%), Positives = 21/46 (45%), Gaps = 4/46 (8%) Frame = -3 Query: 296 PQNEPRPTSLRGREQTHMSN----TCLTXPRN*STPRTKT*NQKPR 171 P N+PRP S R TH + TC+ P P +T + P+ Sbjct: 220 PHNKPRPASSRPHPATHPTQRPCFTCMGRPEIPDEPSWQTGDDDPQ 265
>41_BOVIN (Q9N179) Protein 4.1 (Band 4.1) (P4.1) (4.1R)| Length = 617 Score = 27.3 bits (59), Expect = 9.8 Identities = 11/33 (33%), Positives = 19/33 (57%) Frame = -1 Query: 220 LEINQLLEPKLETKNQDKKIWKKKRERCERTNL 122 +E+ Q P + + + + WKKKRER + N+ Sbjct: 380 VEVKQEEAPPEDAEPEPSEAWKKKRERLDGENI 412 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 44,480,629 Number of Sequences: 219361 Number of extensions: 748463 Number of successful extensions: 2276 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2202 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2275 length of database: 80,573,946 effective HSP length: 83 effective length of database: 62,366,983 effective search space used: 1496807592 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)