| Clone Name | bags25j06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YS81_CAEEL (Q09621) Hypothetical protein ZK945.1 | 30 | 4.9 | 2 | ACON_MYCAV (O08451) Aconitate hydratase (EC 4.2.1.3) (Citrate hy... | 30 | 4.9 | 3 | RM02_CANGA (Q6FS31) 60S ribosomal protein L2, mitochondrial prec... | 30 | 6.3 | 4 | YO111_YEAST (Q99210) Protein YOR111W | 30 | 6.3 | 5 | ACE1_TRIRE (Q9P8W3) Zinc finger transcription factor ace1 (ACEI) | 30 | 8.3 | 6 | TUSC_VIBVU (Q8DCR2) Protein tusC homolog | 30 | 8.3 |
|---|
>YS81_CAEEL (Q09621) Hypothetical protein ZK945.1| Length = 473 Score = 30.4 bits (67), Expect = 4.9 Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 2/36 (5%) Frame = -3 Query: 559 CIEVLLDEYNDRGLVSHDDKTS--WPEYTIHFKEQI 458 C+ +L+D RG +S+DDK S WPE+ + KE I Sbjct: 138 CVAMLVD----RGHISYDDKMSKIWPEFAQNGKENI 169
>ACON_MYCAV (O08451) Aconitate hydratase (EC 4.2.1.3) (Citrate hydro-lyase)| (Aconitase) Length = 961 Score = 30.4 bits (67), Expect = 4.9 Identities = 16/40 (40%), Positives = 22/40 (55%) Frame = +2 Query: 68 PARLTTPPPRLADLYVTADTFEKDTEMWQQRVDNYWNLLR 187 PA L +ADL+ TAD FE++ E+ QR + LR Sbjct: 146 PADLVIDHSVIADLFGTADAFERNVEIEYQRNGERYQFLR 185
>RM02_CANGA (Q6FS31) 60S ribosomal protein L2, mitochondrial precursor| Length = 368 Score = 30.0 bits (66), Expect = 6.3 Identities = 17/48 (35%), Positives = 27/48 (56%), Gaps = 4/48 (8%) Frame = +2 Query: 110 YVTADTFEKD-TEMWQQR---VDNYWNLLRPKIKPESIRNIMDMKANF 241 Y++ DT KD TE +R +DNYWN + ++K I +M +N+ Sbjct: 145 YLSRDTLLKDLTEREAKRHEMMDNYWNFISSELKLNIIPERKEMASNY 192
>YO111_YEAST (Q99210) Protein YOR111W| Length = 232 Score = 30.0 bits (66), Expect = 6.3 Identities = 20/56 (35%), Positives = 30/56 (53%) Frame = +2 Query: 338 GLIGSTHDWCEAFSTYPRTYDLLHAWTVFTDLEKRGCSAEDLLLEMDRILRPTGFI 505 G I S +D A ST PR Y++LH TDL+ + E+ L +M+ P G++ Sbjct: 13 GFICSKYDIILA-STSPRRYEILHDIMGITDLKTMVSTFEENLDKMNYSTDPIGYV 67
>ACE1_TRIRE (Q9P8W3) Zinc finger transcription factor ace1 (ACEI)| Length = 733 Score = 29.6 bits (65), Expect = 8.3 Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 1/58 (1%) Frame = -3 Query: 592 AIHNSYCLP-VKCIEVLLDEYNDRGLVSHDDKTSWPEYTIHFKEQIFSTATSFLKVGE 422 A++ +CL V+CI+ ++ DR V D+ Y I KEQI+ + E Sbjct: 252 ALYLDFCLTSVRCIQATVEYLTDREQVRPGDRPYTNGYFIDLKEQIYQYGKQLAAIKE 309
>TUSC_VIBVU (Q8DCR2) Protein tusC homolog| Length = 118 Score = 29.6 bits (65), Expect = 8.3 Identities = 11/28 (39%), Positives = 20/28 (71%) Frame = +2 Query: 395 YDLLHAWTVFTDLEKRGCSAEDLLLEMD 478 YD+ H + L++RG ++EDLL+E++ Sbjct: 71 YDIEHVYVCQQSLQQRGLTSEDLLIEVE 98 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 101,032,511 Number of Sequences: 219361 Number of extensions: 2172575 Number of successful extensions: 5763 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 5558 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5762 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)