| Clone Name | bags25j02 |
|---|---|
| Clone Library Name | barley_pub |
>TRMU_XYLFA (Q9PDD9) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 379 Score = 32.0 bits (71), Expect = 1.2 Identities = 14/46 (30%), Positives = 23/46 (50%) Frame = +2 Query: 392 NLDCLKYSTTKYTRFLHPLKR*KTSTISTGHYVQRRRQWQEWHIVQ 529 N D L K+ FL + +I+TGHY + + Q WH+++ Sbjct: 94 NPDVLCNREIKFKHFLETARELGADSIATGHYARIKHYRQRWHLLR 139
>UBP21_SCHPO (Q9UTT1) Ubiquitin carboxyl-terminal hydrolase 21 (EC 3.1.2.15)| (Ubiquitin thioesterase 21) (Ubiquitin-specific processing protease 21) (Deubiquitinating enzyme 21) Length = 1129 Score = 31.6 bits (70), Expect = 1.5 Identities = 16/43 (37%), Positives = 27/43 (62%), Gaps = 1/43 (2%) Frame = +1 Query: 346 MKVIVNQVDLSHPDAE-LRLLEVFYHKIYKIFAPTEKIENIND 471 ++ + +V L+ DA LRL EV+ H+I K PT+ I ++N+ Sbjct: 957 LRQVTQKVPLNAEDASRLRLYEVYNHRILKSHLPTDGIYDLNE 999
>ORC3_YEAST (P54790) Origin recognition complex subunit 3 (Origin recognition| complex protein 62 kDa subunit) Length = 616 Score = 30.8 bits (68), Expect = 2.6 Identities = 17/45 (37%), Positives = 26/45 (57%), Gaps = 1/45 (2%) Frame = -2 Query: 438 KNLVYFVVEYFKQSKFSIRMGQVNL-IDNDFHMTSLKTSPTMLFF 307 K L Y ++ YF Q+ FS+ + VN+ ND ++ L PT +FF Sbjct: 319 KMLDYSLMSYFFQNAFSVFIDPVNVDFLNDDYLKILSRCPTFMFF 363
>TRMU_XYLFT (Q87DM0) Probable tRNA| (5-methylaminomethyl-2-thiouridylate)-methyltransferase (EC 2.1.1.61) Length = 379 Score = 30.4 bits (67), Expect = 3.4 Identities = 14/46 (30%), Positives = 21/46 (45%) Frame = +2 Query: 392 NLDCLKYSTTKYTRFLHPLKR*KTSTISTGHYVQRRRQWQEWHIVQ 529 N D L K+ FL + I+TGHY + Q WH+++ Sbjct: 94 NPDVLCNREIKFKHFLETARELGADRIATGHYARIEHYRQRWHLLR 139
>JNK1_CAEEL (Q8WQG9) Stress-activated protein kinase jnk-1 (EC 2.7.11.24)| Length = 463 Score = 29.6 bits (65), Expect = 5.9 Identities = 14/54 (25%), Positives = 28/54 (51%), Gaps = 4/54 (7%) Frame = +1 Query: 391 ELRLLEVFYHK----IYKIFAPTEKIENINDQYWTLRAEEASMARVAYCTVEED 540 EL+L+ + HK I F P +K++ ND Y + +A++ +V ++ + Sbjct: 166 ELKLMSLVNHKNIIGILNCFTPQKKLDEFNDLYIVMELMDANLCQVIQMDLDHE 219
>ERA_BACHD (Q9KD52) GTP-binding protein era homolog| Length = 304 Score = 28.9 bits (63), Expect = 10.0 Identities = 10/24 (41%), Positives = 17/24 (70%) Frame = +1 Query: 352 VIVNQVDLSHPDAELRLLEVFYHK 423 +++N++D HPD L L+E + HK Sbjct: 123 LVINKIDKVHPDDLLSLIETYRHK 146 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 72,324,708 Number of Sequences: 219361 Number of extensions: 1367591 Number of successful extensions: 2809 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 2779 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2809 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4430660157 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)