| Clone Name | bags25d14 |
|---|---|
| Clone Library Name | barley_pub |
>ASPM_CANFA (P62286) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 3452 Score = 32.3 bits (72), Expect = 0.74 Identities = 15/36 (41%), Positives = 25/36 (69%) Frame = -3 Query: 264 YSTRKMNQGAQCSHLFDLNVSLILVNQEVKQENKIF 157 YS RK N C+ + + +SL LVN+E+++ENK++ Sbjct: 3210 YSWRKKND---CTKIKAIRLSLQLVNREIREENKLY 3242
>ASPM_FELCA (P62288) Abnormal spindle-like microcephaly-associated protein| homolog (Fragment) Length = 3461 Score = 31.6 bits (70), Expect = 1.3 Identities = 15/36 (41%), Positives = 24/36 (66%) Frame = -3 Query: 264 YSTRKMNQGAQCSHLFDLNVSLILVNQEVKQENKIF 157 YS RK N G + + +SL LVN+E+++ENK++ Sbjct: 3219 YSWRKKNDGTKIKAI---RLSLQLVNREIREENKLY 3251
>ASPM_MACFA (P62291) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3476 Score = 31.2 bits (69), Expect = 1.7 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = -3 Query: 264 YSTRKMNQGAQCSHLFDLNVSLILVNQEVKQENKIF 157 YS RK N C+ + + +SL +VN+E+++ENK++ Sbjct: 3217 YSWRKKND---CTKIKAIRLSLQVVNREIREENKLY 3249
>ASPM_GORGO (P62289) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3476 Score = 31.2 bits (69), Expect = 1.7 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = -3 Query: 264 YSTRKMNQGAQCSHLFDLNVSLILVNQEVKQENKIF 157 YS RK N C+ + + +SL +VN+E+++ENK++ Sbjct: 3217 YSWRKKND---CTKIKAIRLSLQVVNREIREENKLY 3249
>ASPM_PONPY (P62294) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3471 Score = 31.2 bits (69), Expect = 1.7 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = -3 Query: 264 YSTRKMNQGAQCSHLFDLNVSLILVNQEVKQENKIF 157 YS RK N C+ + + +SL +VN+E+++ENK++ Sbjct: 3212 YSWRKKND---CTKIKAIRLSLQVVNREIREENKLY 3244
>ASPM_MACMU (P62292) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3479 Score = 31.2 bits (69), Expect = 1.7 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = -3 Query: 264 YSTRKMNQGAQCSHLFDLNVSLILVNQEVKQENKIF 157 YS RK N C+ + + +SL +VN+E+++ENK++ Sbjct: 3220 YSWRKKND---CTKIKAIRLSLQVVNREIREENKLY 3252
>ASPM_PANTR (P62293) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3477 Score = 31.2 bits (69), Expect = 1.7 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = -3 Query: 264 YSTRKMNQGAQCSHLFDLNVSLILVNQEVKQENKIF 157 YS RK N C+ + + +SL +VN+E+++ENK++ Sbjct: 3218 YSWRKKND---CTKIKAIRLSLQVVNREIREENKLY 3250
>ASPM_HYLLA (P62290) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3477 Score = 31.2 bits (69), Expect = 1.7 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = -3 Query: 264 YSTRKMNQGAQCSHLFDLNVSLILVNQEVKQENKIF 157 YS RK N C+ + + +SL +VN+E+++ENK++ Sbjct: 3218 YSWRKKND---CTKIKAIRLSLQVVNREIREENKLY 3250
>ASPM_HUMAN (Q8IZT6) Abnormal spindle-like microcephaly-associated protein| (Abnormal spindle protein homolog) (Asp homolog) Length = 3477 Score = 31.2 bits (69), Expect = 1.7 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = -3 Query: 264 YSTRKMNQGAQCSHLFDLNVSLILVNQEVKQENKIF 157 YS RK N C+ + + +SL +VN+E+++ENK++ Sbjct: 3218 YSWRKKND---CTKIKAIRLSLQVVNREIREENKLY 3250
>ASPM_COLGU (P62287) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3477 Score = 31.2 bits (69), Expect = 1.7 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = -3 Query: 264 YSTRKMNQGAQCSHLFDLNVSLILVNQEVKQENKIF 157 YS RK N C+ + + +SL +VN+E+++ENK++ Sbjct: 3218 YSWRKKND---CTKIKAIRLSLQVVNREIREENKLY 3250
>ASPM_SAIBB (P62296) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3469 Score = 30.8 bits (68), Expect = 2.2 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = -3 Query: 264 YSTRKMNQGAQCSHLFDLNVSLILVNQEVKQENKIF 157 YS RK N C+ + + +SL +VN+E+++ENK++ Sbjct: 3210 YSWRKNND---CTKIKAIRLSLQVVNREIREENKLY 3242
>ASPM_AOTVO (P62283) Abnormal spindle-like microcephaly-associated protein| homolog Length = 3473 Score = 30.8 bits (68), Expect = 2.2 Identities = 14/36 (38%), Positives = 25/36 (69%) Frame = -3 Query: 264 YSTRKMNQGAQCSHLFDLNVSLILVNQEVKQENKIF 157 YS RK N C+ + + +SL +VN+E+++ENK++ Sbjct: 3214 YSWRKNND---CTKIKAIRLSLQVVNREIREENKLY 3246 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,201,563 Number of Sequences: 219361 Number of extensions: 1092846 Number of successful extensions: 2164 Number of sequences better than 10.0: 12 Number of HSP's better than 10.0 without gapping: 2121 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2164 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)