ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags25a23 |
|---|---|
| Clone Library Name | barley_pub |
>GTOMC_ARATH (Q9ZSK1) Tocopherol O-methyltransferase, chloroplast precursor (EC| 2.1.1.95) (Gamma-tocopherol methyltransferase) Length = 348 Score = 105 bits (263), Expect = 5e-23 Identities = 49/59 (83%), Positives = 55/59 (93%) Frame = +2 Query: 2 ENVAPFWPAVIQSALTWKGLTSLLRSGWKTIKGALVMPLMIQGYKKGLIKFTIITCRKP 178 ENVAPFWPAVI++ALTWKGL SLLRSG K+IKGAL MPLMI+GYKKG+IKF IITC+KP Sbjct: 289 ENVAPFWPAVIRTALTWKGLVSLLRSGMKSIKGALTMPLMIEGYKKGVIKFGIITCQKP 347
>ARNT_SALTY (O52327) Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose| arabinosyl transferase (EC 2.-.-.-) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) (4-amino-4-deoxy-L-arabinose lipid A transferase) (Polymyxin resistance protein pmrK) Length = 547 Score = 38.9 bits (89), Expect = 0.008 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 10/72 (13%) Frame = +2 Query: 2 ENVAPFW---PAVIQSALTWKGLT-SLLRSGWKTIKGAL------VMPLMIQGYKKGLIK 151 ++ APFW P ++ +L W GL L+ GW+ GA +MPL+ KG + Sbjct: 252 QHKAPFWYYLPVLLAGSLPWLGLLPGALKLGWRERNGAFYLLGWTIMPLLFFSIAKGKLP 311 Query: 152 FTIITCRKPQAV 187 +++C P A+ Sbjct: 312 TYVLSCFAPIAI 323
>ARNT_SALTI (Q8Z538) Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose| arabinosyl transferase (EC 2.-.-.-) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) (4-amino-4-deoxy-L-arabinose lipid A transferase) (Polymyxin resistance protein pmrK) (Mel Length = 547 Score = 38.9 bits (89), Expect = 0.008 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 10/72 (13%) Frame = +2 Query: 2 ENVAPFW---PAVIQSALTWKGLT-SLLRSGWKTIKGAL------VMPLMIQGYKKGLIK 151 ++ APFW P ++ +L W GL L+ GW+ GA +MPL+ KG + Sbjct: 252 QHKAPFWYYLPVLLAGSLPWLGLLPGALKLGWRERNGAFYLLGWTIMPLLFFSIAKGKLP 311 Query: 152 FTIITCRKPQAV 187 +++C P A+ Sbjct: 312 TYVLSCFAPIAI 323
>ARNT_SALPA (Q5PNA8) Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose| arabinosyl transferase (EC 2.-.-.-) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) (4-amino-4-deoxy-L-arabinose lipid A transferase) Length = 547 Score = 38.9 bits (89), Expect = 0.008 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 10/72 (13%) Frame = +2 Query: 2 ENVAPFW---PAVIQSALTWKGLT-SLLRSGWKTIKGAL------VMPLMIQGYKKGLIK 151 ++ APFW P ++ +L W GL L+ GW+ GA +MPL+ KG + Sbjct: 252 QHKAPFWYYLPVLLAGSLPWLGLLPGALKLGWRERNGAFYLLGWTIMPLLFFSIAKGKLP 311 Query: 152 FTIITCRKPQAV 187 +++C P A+ Sbjct: 312 TYVLSCFAPIAI 323
>ARNT_SALCH (Q57M54) Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose| arabinosyl transferase (EC 2.-.-.-) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) (4-amino-4-deoxy-L-arabinose lipid A transferase) Length = 547 Score = 38.9 bits (89), Expect = 0.008 Identities = 22/72 (30%), Positives = 36/72 (50%), Gaps = 10/72 (13%) Frame = +2 Query: 2 ENVAPFW---PAVIQSALTWKGLT-SLLRSGWKTIKGAL------VMPLMIQGYKKGLIK 151 ++ APFW P ++ +L W GL L+ GW+ GA +MPL+ KG + Sbjct: 252 QHKAPFWYYLPVLLAGSLPWLGLLPGALKLGWRERNGAFYLLGWTIMPLLFFSIAKGKLP 311 Query: 152 FTIITCRKPQAV 187 +++C P A+ Sbjct: 312 TYVLSCFAPIAI 323
>ARNT_ECOL6 (Q8FFL9) Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose| arabinosyl transferase (EC 2.-.-.-) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) (4-amino-4-deoxy-L-arabinose lipid A transferase) Length = 550 Score = 38.1 bits (87), Expect = 0.014 Identities = 25/71 (35%), Positives = 34/71 (47%), Gaps = 12/71 (16%) Frame = +2 Query: 11 APFW---PAVIQSALTWKGLT-SLLRSGWKTIKGAL--------VMPLMIQGYKKGLIKF 154 APFW P VI +L W GL L +GWK K + +MPL+ KG + Sbjct: 255 APFWYYLPVVIAGSLPWLGLLPGALYAGWKNRKHSATVYLLSWTIMPLLFFSVAKGKLPT 314 Query: 155 TIITCRKPQAV 187 I++C P A+ Sbjct: 315 YILSCFAPLAM 325
>ARNT_SHIFL (Q83KB6) Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose| arabinosyl transferase (EC 2.-.-.-) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) (4-amino-4-deoxy-L-arabinose lipid A transferase) Length = 550 Score = 37.7 bits (86), Expect = 0.018 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 12/71 (16%) Frame = +2 Query: 11 APFW---PAVIQSALTWKGLT-SLLRSGWKTIKGAL--------VMPLMIQGYKKGLIKF 154 APFW P +I +L W GL L +GWK K + +MPL+ KG + Sbjct: 255 APFWYYVPVIIAGSLPWLGLLPGALYTGWKNRKHSATVYLLSWTIMPLLFFSVAKGKLPT 314 Query: 155 TIITCRKPQAV 187 I++C P A+ Sbjct: 315 YILSCFAPLAM 325
>ARNT_ECO57 (Q8XDZ1) Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose| arabinosyl transferase (EC 2.-.-.-) (Undecaprenyl phosphate-alpha-L-Ara4N transferase) (4-amino-4-deoxy-L-arabinose lipid A transferase) Length = 550 Score = 37.7 bits (86), Expect = 0.018 Identities = 24/71 (33%), Positives = 34/71 (47%), Gaps = 12/71 (16%) Frame = +2 Query: 11 APFW---PAVIQSALTWKGLT-SLLRSGWKTIKGAL--------VMPLMIQGYKKGLIKF 154 APFW P +I +L W GL L +GWK K + +MPL+ KG + Sbjct: 255 APFWYYVPVIIAGSLPWLGLLPGALYTGWKNRKHSATVYLLSWTIMPLLFFSVAKGKLPT 314 Query: 155 TIITCRKPQAV 187 I++C P A+ Sbjct: 315 YILSCFAPLAM 325
>Y32K_MCMV (P11641) Hypothetical 32.7 kDa protein [Contains: Hypothetical 9| kDa protein] Length = 290 Score = 30.0 bits (66), Expect = 3.7 Identities = 17/56 (30%), Positives = 31/56 (55%), Gaps = 3/56 (5%) Frame = -2 Query: 433 NKAQMGQVCKMTKNDGCNQKSP**I*REFCFRNHFSY--GTCSCRYI-GMVTRKFS 275 N+ + V K+TK++G + I +E NHF++ G C CR++ V ++F+ Sbjct: 43 NQLENIAVGKLTKSEGAPAQQNVIIAKEVVINNHFNFNAGVCVCRFVLASVVKEFN 98
>GSH2_HUMAN (Q9BZM3) Homeobox protein GSH-2| Length = 304 Score = 28.9 bits (63), Expect = 8.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 6/33 (18%) Frame = +1 Query: 106 GDASHDPRLQER------PDQVHHHHLPQTPSS 186 GDA PR+ P HHHH PQ P S Sbjct: 114 GDAQFCPRVNHAHHHHHPPQHHHHHHQPQQPGS 146
>GSH2_MOUSE (P31316) Homeobox protein GSH-2| Length = 305 Score = 28.9 bits (63), Expect = 8.2 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 6/33 (18%) Frame = +1 Query: 106 GDASHDPRLQER------PDQVHHHHLPQTPSS 186 GDA PR+ P HHHH PQ P S Sbjct: 114 GDAQFCPRVSHAHHHHHPPQHHHHHHQPQQPGS 146 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 73,655,369 Number of Sequences: 219361 Number of extensions: 1470770 Number of successful extensions: 3666 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3464 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3645 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
