ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags24g18 |
|---|---|
| Clone Library Name | barley_pub |
>CAND1_RAT (P97536) Cullin-associated NEDD8-dissociated protein 1| (Cullin-associated and neddylation-dissociated protein 1) (p120 CAND1) (TBP-interacting protein TIP120A) (TBP-interacting protein of 120 kDa A) Length = 1230 Score = 82.8 bits (203), Expect = 5e-16 Identities = 38/72 (52%), Positives = 55/72 (76%) Frame = +1 Query: 295 VAMANTNITGILEKMTGKDKDYRYMATSDLLSELNKESFKADQDLESKLTNIVLQQLEDA 474 +A A+ +I+ +LEKMT DKD+R+MAT+DL++EL K+S K D D E K+ ++L+ LED Sbjct: 1 MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDK 60 Query: 475 SGDVSGLAVKCL 510 +G+V LAVKCL Sbjct: 61 NGEVQNLAVKCL 72
>CAND1_MOUSE (Q6ZQ38) Cullin-associated NEDD8-dissociated protein 1| (Cullin-associated and neddylation-dissociated protein 1) (p120 CAND1) Length = 1230 Score = 82.8 bits (203), Expect = 5e-16 Identities = 38/72 (52%), Positives = 55/72 (76%) Frame = +1 Query: 295 VAMANTNITGILEKMTGKDKDYRYMATSDLLSELNKESFKADQDLESKLTNIVLQQLEDA 474 +A A+ +I+ +LEKMT DKD+R+MAT+DL++EL K+S K D D E K+ ++L+ LED Sbjct: 1 MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILRLLEDK 60 Query: 475 SGDVSGLAVKCL 510 +G+V LAVKCL Sbjct: 61 NGEVQNLAVKCL 72
>CAND1_HUMAN (Q86VP6) Cullin-associated NEDD8-dissociated protein 1| (Cullin-associated and neddylation-dissociated protein 1) (p120 CAND1) (TBP-interacting protein TIP120A) (TBP-interacting protein of 120 kDa A) Length = 1230 Score = 82.8 bits (203), Expect = 5e-16 Identities = 38/72 (52%), Positives = 55/72 (76%) Frame = +1 Query: 295 VAMANTNITGILEKMTGKDKDYRYMATSDLLSELNKESFKADQDLESKLTNIVLQQLEDA 474 +A A+ +I+ +LEKMT DKD+R+MAT+DL++EL K+S K D D E K+ ++L+ LED Sbjct: 1 MASASYHISNLLEKMTSSDKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLLEDK 60 Query: 475 SGDVSGLAVKCL 510 +G+V LAVKCL Sbjct: 61 NGEVQNLAVKCL 72
>CAND2_MOUSE (Q6ZQ73) Cullin-associated NEDD8-dissociated protein 2| (Cullin-associated and neddylation-dissociated protein 2) (p120 CAND2) (TBP-interacting protein TIP120B) (TBP-interacting protein of 120 kDa B) Length = 1235 Score = 80.9 bits (198), Expect = 2e-15 Identities = 38/65 (58%), Positives = 50/65 (76%) Frame = +1 Query: 316 ITGILEKMTGKDKDYRYMATSDLLSELNKESFKADQDLESKLTNIVLQQLEDASGDVSGL 495 I+ +LEKMT DKD+R+MATSDL+SEL K+S + D+D E K+ +L+ LED SG+V L Sbjct: 8 ISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVVRTLLRLLEDRSGEVQNL 67 Query: 496 AVKCL 510 AVKCL Sbjct: 68 AVKCL 72
>CAND1_PONPY (Q5R6L5) Cullin-associated NEDD8-dissociated protein 1| (Cullin-associated and neddylation-dissociated protein 1) (p120 CAND1) Length = 1230 Score = 77.8 bits (190), Expect = 2e-14 Identities = 36/72 (50%), Positives = 53/72 (73%) Frame = +1 Query: 295 VAMANTNITGILEKMTGKDKDYRYMATSDLLSELNKESFKADQDLESKLTNIVLQQLEDA 474 +A A+ +I+ +LEKMT KD+R+MAT+DL++EL K+S K D D E K+ ++L+ ED Sbjct: 1 MASASYHISNLLEKMTSSGKDFRFMATNDLMTELQKDSIKLDDDSERKVVKMILKLQEDK 60 Query: 475 SGDVSGLAVKCL 510 +G+V LAVKCL Sbjct: 61 NGEVQNLAVKCL 72
>CAND2_HUMAN (O75155) Cullin-associated NEDD8-dissociated protein 2| (Cullin-associated and neddylation-dissociated protein 2) (p120 CAND2) Length = 1119 Score = 77.0 bits (188), Expect = 3e-14 Identities = 37/72 (51%), Positives = 54/72 (75%) Frame = +1 Query: 295 VAMANTNITGILEKMTGKDKDYRYMATSDLLSELNKESFKADQDLESKLTNIVLQQLEDA 474 ++ A +I+ +LEKMT DKD+R+MATSDL+SEL K+S + D+D E K+ ++L+ LED Sbjct: 1 MSTAAFHISSLLEKMTSSDKDFRFMATSDLMSELQKDSIQLDEDSERKVVKMLLRLLEDK 60 Query: 475 SGDVSGLAVKCL 510 +G+V LAVK L Sbjct: 61 NGEVQNLAVKWL 72
>CAND2_RAT (Q9R0L4) Cullin-associated NEDD8-dissociated protein 2| (Cullin-associated and neddylation-dissociated protein 2) (p120 CAND2) (TBP-interacting protein TIP120B) (TBP-interacting protein of 120 kDa B) (TBP-interacting protein b) Length = 1273 Score = 62.0 bits (149), Expect = 9e-10 Identities = 38/103 (36%), Positives = 50/103 (48%), Gaps = 38/103 (36%) Frame = +1 Query: 316 ITGILEKMTGKDKDY--------------------------------------RYMATSD 381 I+ +LEKMT DKD+ R+MATSD Sbjct: 8 ISSLLEKMTSSDKDFSPKSLGGSRVLDPLPWLQILAAITDWISGDRTQDLALPRFMATSD 67 Query: 382 LLSELNKESFKADQDLESKLTNIVLQQLEDASGDVSGLAVKCL 510 L+SEL K+S + D+D E K+ +L+ LED SG+V LAVKCL Sbjct: 68 LMSELQKDSIQLDEDSERKVVRTLLRLLEDRSGEVQNLAVKCL 110
>ZN644_HUMAN (Q9H582) Zinc finger protein 644 (Zinc finger motif| enhancer-binding protein 2) (Zep-2) Length = 1327 Score = 31.2 bits (69), Expect = 1.7 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 6/47 (12%) Frame = +1 Query: 352 KDYRYMATSDLLSELNKESFKADQDLES------KLTNIVLQQLEDA 474 KD+R +A ++ E KES +DL+S K+T +VLQ+L A Sbjct: 801 KDHRRVAVKRVIKESKKESSVGGEDLDSYPDFLHKMTVVVLQKLNSA 847
>MCSP_RAT (Q64298) Sperm mitochondrial-associated cysteine-rich protein| Length = 145 Score = 30.8 bits (68), Expect = 2.3 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = -2 Query: 99 KESQCCTTPCCAARGTTPPQ 40 K +QCC TPCC + PP+ Sbjct: 6 KTNQCCPTPCCPPKPCCPPK 25
>YKZ6_YEAST (P36112) Hypothetical 61.1 kDa protein in YPT52-DBP7 intergenic| region Length = 540 Score = 29.6 bits (65), Expect = 5.0 Identities = 13/54 (24%), Positives = 31/54 (57%) Frame = +1 Query: 310 TNITGILEKMTGKDKDYRYMATSDLLSELNKESFKADQDLESKLTNIVLQQLED 471 TN++ + E + +Y TS++++ELN + + ++ E L +LQ++++ Sbjct: 184 TNLSQLNETLKEALSNYMIQRTSEVITELNTQYENSKREFEKNLQKNLLQEVDE 237
>TRI17_HUMAN (Q9Y577) Tripartite motif protein 17 (Testis RING finger protein)| (RING finger protein 16) Length = 477 Score = 29.3 bits (64), Expect = 6.6 Identities = 21/54 (38%), Positives = 28/54 (51%) Frame = +2 Query: 194 LRQVSDRIEAKQASLLLLEDTVEYLCEEDLNTGLSRWRIQT*PASWRR*QGKIK 355 L +V EA Q L LE+ +EYL E+ TG + R + A W QGK+K Sbjct: 129 LHRVLPAEEAVQGYKLKLEEDMEYLREQITRTGNLQAREEQSLAEW---QGKVK 179 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,344,436 Number of Sequences: 219361 Number of extensions: 1009912 Number of successful extensions: 3305 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3064 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3297 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3812186532 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
