| Clone Name | bags24f12 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | CYSP_SALTY (P41031) Thiosulfate-binding protein precursor | 29 | 7.4 | 2 | CYSP_ECOLI (P16700) Thiosulfate-binding protein precursor | 29 | 7.4 | 3 | VL1_BPV3 (P50805) Major capsid protein L1 | 29 | 7.4 | 4 | ALA5_ARATH (Q9SGG3) Putative phospholipid-transporting ATPase 5 ... | 29 | 7.4 | 5 | ZSWM2_HUMAN (Q8NEG5) Zinc finger SWIM domain-containing protein 2 | 29 | 9.6 |
|---|
>CYSP_SALTY (P41031) Thiosulfate-binding protein precursor| Length = 338 Score = 29.3 bits (64), Expect = 7.4 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = -2 Query: 282 PPFHSRWMLST--DFLTIFPSHAGSGKQ 205 PPF +W D LTI SHAGS KQ Sbjct: 45 PPFEQQWAKDNGGDKLTIKQSHAGSSKQ 72
>CYSP_ECOLI (P16700) Thiosulfate-binding protein precursor| Length = 338 Score = 29.3 bits (64), Expect = 7.4 Identities = 15/28 (53%), Positives = 16/28 (57%), Gaps = 2/28 (7%) Frame = -2 Query: 282 PPFHSRWMLST--DFLTIFPSHAGSGKQ 205 PPF +W D LTI SHAGS KQ Sbjct: 45 PPFEQQWAKDNGGDKLTIKQSHAGSSKQ 72
>VL1_BPV3 (P50805) Major capsid protein L1| Length = 510 Score = 29.3 bits (64), Expect = 7.4 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 2/58 (3%) Frame = +3 Query: 90 WDNGYRITATAATLDQAAFILSIPRRKPNDETQETLRTSAFPS--QHVKEKWSKNLYL 257 W+N +TA +T F +S+ R KP+ E Q+T + F +HV E+W +L L Sbjct: 326 WNNQLFVTAVDSTRG-TNFTISVHRDKPSLEDQDTYTAAEFKHYLRHV-EEWEVSLVL 381
>ALA5_ARATH (Q9SGG3) Putative phospholipid-transporting ATPase 5 (EC 3.6.3.1)| (Aminophospholipid flippase 5) Length = 1228 Score = 29.3 bits (64), Expect = 7.4 Identities = 11/24 (45%), Positives = 15/24 (62%) Frame = +3 Query: 12 HVPKCWFLRPVVELDFLYPSEGIH 83 H+PK W+LRP +DF P I+ Sbjct: 331 HMPKMWYLRPGEPIDFTNPINPIY 354
>ZSWM2_HUMAN (Q8NEG5) Zinc finger SWIM domain-containing protein 2| Length = 633 Score = 28.9 bits (63), Expect = 9.6 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +2 Query: 77 HPSTMG*WLSHHCNSCHIGPGCIY 148 H + WL H CNSC IG IY Sbjct: 367 HRKCIDNWLFHKCNSCPIGGQVIY 390 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 74,743,479 Number of Sequences: 219361 Number of extensions: 1457483 Number of successful extensions: 2796 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 2732 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2795 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4258037034 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)