| Clone Name | bags23o16 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | NU5M_BALPH (P24978) NADH-ubiquinone oxidoreductase chain 5 (EC 1... | 31 | 3.3 | 2 | SORC3_HUMAN (Q9UPU3) VPS10 domain-containing receptor SorCS3 pre... | 31 | 4.3 | 3 | SORC3_MOUSE (Q8VI51) VPS10 domain-containing receptor SorCS3 pre... | 30 | 5.7 | 4 | Y420_MYCPN (P75367) Hypothetical protein MG293 homolog (A05_orf2... | 30 | 7.4 |
|---|
>NU5M_BALPH (P24978) NADH-ubiquinone oxidoreductase chain 5 (EC 1.6.5.3) (NADH| dehydrogenase subunit 5) Length = 606 Score = 31.2 bits (69), Expect = 3.3 Identities = 21/57 (36%), Positives = 29/57 (50%) Frame = +1 Query: 61 IXSSHGGHREANKQQTNRKNI**FACVTSLIPSI*EVSVTVSFGTSMEVYINTFHMI 231 I SH G NK Q+ KNI A +TSL+P++ V T+ E I+ +H I Sbjct: 19 IMMSHTGSHVNNKYQSYVKNIVFCAFITSLVPAM------VYLHTNQETLISNWHWI 69
>SORC3_HUMAN (Q9UPU3) VPS10 domain-containing receptor SorCS3 precursor| Length = 1222 Score = 30.8 bits (68), Expect = 4.3 Identities = 23/92 (25%), Positives = 39/92 (42%), Gaps = 3/92 (3%) Frame = +3 Query: 150 YPFHLGSICYCQLWNK--YGSIYKHLSHDFSIRSNICYYTHPYMNMNVKHTSTCLDLHSP 323 Y F+LGS+ LW YG+ Y+ L+ +++ + Y+ +N + + L P Sbjct: 218 YDFNLGSVTESSLWRSTDYGTTYEKLNDKVGLKTVL-----SYLYVNPTNKRKIMLLSDP 272 Query: 324 LRNMDIYSFSSE-IIYYKWRILLCSMSIFVFP 416 I S E Y K+R+ S+ P Sbjct: 273 EMESSILISSDEGATYQKYRLTFYIQSLLFHP 304
>SORC3_MOUSE (Q8VI51) VPS10 domain-containing receptor SorCS3 precursor| Length = 1219 Score = 30.4 bits (67), Expect = 5.7 Identities = 22/91 (24%), Positives = 38/91 (41%), Gaps = 2/91 (2%) Frame = +3 Query: 150 YPFHLGSICYCQLWNK--YGSIYKHLSHDFSIRSNICYYTHPYMNMNVKHTSTCLDLHSP 323 Y F+LGS+ LW YG+ Y+ L+ +++ + Y Y+N K L Sbjct: 215 YDFNLGSVTESSLWRSVDYGATYEKLNDKVGLKTVLSYL---YVNPTNKRKIMLLS-DPE 270 Query: 324 LRNMDIYSFSSEIIYYKWRILLCSMSIFVFP 416 + + + S Y K+R+ S+ P Sbjct: 271 MESSVLISSDEGATYQKYRLTFYIQSLLFHP 301
>Y420_MYCPN (P75367) Hypothetical protein MG293 homolog (A05_orf241a)| Length = 241 Score = 30.0 bits (66), Expect = 7.4 Identities = 13/44 (29%), Positives = 25/44 (56%) Frame = +3 Query: 249 ICYYTHPYMNMNVKHTSTCLDLHSPLRNMDIYSFSSEIIYYKWR 380 +C Y HP+ N+ K L L PL +++ +SE+ ++++R Sbjct: 185 VCQYLHPWTNIYEKFPDMVLSLQLPL---GLWTLNSEVKFHQFR 225 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,359,022 Number of Sequences: 219361 Number of extensions: 2072437 Number of successful extensions: 3993 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3918 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3992 length of database: 80,573,946 effective HSP length: 109 effective length of database: 56,663,597 effective search space used: 7309604013 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)