| Clone Name | bags23g17 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | PHY1_SELMA (Q01549) Phytochrome 1 | 31 | 4.1 | 2 | PHYB_SORBI (P93527) Phytochrome B | 30 | 5.3 | 3 | PHY1_PHYPA (P36505) Phytochrome 1 | 30 | 9.1 |
|---|
>PHY1_SELMA (Q01549) Phytochrome 1| Length = 1134 Score = 30.8 bits (68), Expect = 4.1 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -1 Query: 547 EIRQEKLLPFL-LNYPTTEEPEC*RYHFPRTYVTNNTRCHAP 425 EIR+ L P+L L+YP T+ P+ R+ F + V C AP Sbjct: 256 EIRRSDLEPYLGLHYPATDIPQASRFLFMKNRVRMICDCSAP 297
>PHYB_SORBI (P93527) Phytochrome B| Length = 1178 Score = 30.4 bits (67), Expect = 5.3 Identities = 16/41 (39%), Positives = 24/41 (58%), Gaps = 1/41 (2%) Frame = -1 Query: 547 EIRQEKLLPFL-LNYPTTEEPEC*RYHFPRTYVTNNTRCHA 428 E R++ L P+L L+YP T+ P+ R+ F + V CHA Sbjct: 304 ESRRDNLEPYLGLHYPATDIPQASRFLFRQNRVRMIADCHA 344
>PHY1_PHYPA (P36505) Phytochrome 1| Length = 1132 Score = 29.6 bits (65), Expect = 9.1 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%) Frame = -1 Query: 547 EIRQEKLLPFL-LNYPTTEEPEC*RYHFPRTYVTNNTRCHAP 425 EIR+ L P+L L+YP T+ P+ R+ F + V C AP Sbjct: 253 EIRRADLEPYLGLHYPGTDIPQASRFLFMKNKVRIIADCSAP 294 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 96,556,298 Number of Sequences: 219361 Number of extensions: 1935744 Number of successful extensions: 2950 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2847 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2950 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6882837918 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)