| Clone Name | bags23b10 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | EDNRB_RABIT (Q9N0W7) Endothelin B receptor precursor (ET-B) (End... | 33 | 1.0 | 2 | HMEN_DROME (P02836) Segmentation polarity homeobox protein engra... | 32 | 1.8 | 3 | STK36_PONPY (Q5RAJ5) Serine/threonine-protein kinase 36 (EC 2.7.... | 30 | 8.9 | 4 | STK36_HUMAN (Q9NRP7) Serine/threonine-protein kinase 36 (EC 2.7.... | 30 | 8.9 | 5 | THIO_CHLPN (Q9Z7P5) Thioredoxin (TRX) | 30 | 8.9 |
|---|
>EDNRB_RABIT (Q9N0W7) Endothelin B receptor precursor (ET-B) (Endothelin| receptor Non-selective type) Length = 441 Score = 32.7 bits (73), Expect = 1.0 Identities = 23/75 (30%), Positives = 33/75 (44%), Gaps = 5/75 (6%) Frame = +1 Query: 112 STPLPAHATALKKMTTPAASTLRARRGMGELS-----CKIPKQSGVTAAAPRRQPIPCLS 276 S P ++ TP+ T R L +IPK+ G TA APRR P PC Sbjct: 33 SAPATPPLLGASEILTPSTKTSWPRDSNASLPRSSAPAEIPKE-GRTAGAPRRTPPPCQR 91 Query: 277 PVVLRLR*SSFSFLN 321 P ++ +F ++N Sbjct: 92 PTEIK---DTFKYIN 103
>HMEN_DROME (P02836) Segmentation polarity homeobox protein engrailed| Length = 552 Score = 32.0 bits (71), Expect = 1.8 Identities = 21/80 (26%), Positives = 38/80 (47%), Gaps = 9/80 (11%) Frame = +1 Query: 70 VSRPVASKACSFLGSTPLPAHATALKKMTTPAASTLRARRGMGELSCKIPKQ-------- 225 +++P S + S L S P ++A+ + ++ A S+ + G + + Sbjct: 314 MTQPPLSSSASSLASPPPASNASTISSTSSVATSSSSSSSGCSSAASSLNSSPSSRLGAS 373 Query: 226 -SGVTAAAPRRQPIPCLSPV 282 SGV A++P+ QPIP S V Sbjct: 374 GSGVNASSPQPQPIPPPSAV 393
>STK36_PONPY (Q5RAJ5) Serine/threonine-protein kinase 36 (EC 2.7.11.1) (Fused| homolog) Length = 1315 Score = 29.6 bits (65), Expect = 8.9 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +2 Query: 209 ARFPSKAVSLLQHQGGNQSLA*VQWYCAFASLLLASLTMHALVSFNL 349 A P +SLL+H + SL WY F L+A + + +FNL Sbjct: 499 AGLPGLLLSLLRHSQESNSLQQQSWYGTFLQDLMAVIQAYFACTFNL 545
>STK36_HUMAN (Q9NRP7) Serine/threonine-protein kinase 36 (EC 2.7.11.1) (Fused| homolog) Length = 1315 Score = 29.6 bits (65), Expect = 8.9 Identities = 16/47 (34%), Positives = 23/47 (48%) Frame = +2 Query: 209 ARFPSKAVSLLQHQGGNQSLA*VQWYCAFASLLLASLTMHALVSFNL 349 A P +SLL+H + SL WY F L+A + + +FNL Sbjct: 499 AGLPGLLLSLLRHSQESNSLQQQSWYGTFLQDLMAVIQAYFACTFNL 545
>THIO_CHLPN (Q9Z7P5) Thioredoxin (TRX)| Length = 102 Score = 29.6 bits (65), Expect = 8.9 Identities = 14/26 (53%), Positives = 16/26 (61%), Gaps = 2/26 (7%) Frame = -3 Query: 264 DWLPPWC--CSSDTALLGNLAAELPH 193 D+ WC C T +L NLAAELPH Sbjct: 22 DFFAEWCGPCRMLTPILENLAAELPH 47 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 94,645,650 Number of Sequences: 219361 Number of extensions: 1867928 Number of successful extensions: 4582 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 4468 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4580 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6712189044 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)