ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags22l03 |
|---|---|
| Clone Library Name | barley_pub |
>EF1B_ORYSA (P29545) Elongation factor 1-beta (EF-1-beta) (Elongation factor| 1B-alpha 2) (eEF-1B alpha) (Elongation factor 1-beta') (EF-1-beta') Length = 223 Score = 60.1 bits (144), Expect = 1e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = +3 Query: 6 LDDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 +DDLVSVD+LIEE L E PINE+VQSCDIVAFNKI Sbjct: 189 VDDLVSVDSLIEEHLTEEPINEFVQSCDIVAFNKI 223
>EF1D2_ARATH (Q9SI20) Elongation factor 1-delta 2 (EF-1-delta 2) (Elongation| factor 1B-beta 2) (eEF-1B beta 2) Length = 231 Score = 59.7 bits (143), Expect = 2e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 6 LDDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 +DDLVS+DT+IEE L PINEYVQSCDIVAFNKI Sbjct: 197 VDDLVSIDTMIEEQLTVEPINEYVQSCDIVAFNKI 231
>EF1D1_ARATH (P48006) Elongation factor 1-delta 1 (EF-1-delta 1) (Elongation| factor 1B-beta 1) (eEF-1B beta 1) Length = 231 Score = 59.7 bits (143), Expect = 2e-09 Identities = 28/35 (80%), Positives = 31/35 (88%) Frame = +3 Query: 6 LDDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 +DDLVS+DT+IEE L PINEYVQSCDIVAFNKI Sbjct: 197 VDDLVSIDTMIEEQLTVEPINEYVQSCDIVAFNKI 231
>EF1B_WHEAT (P29546) Elongation factor 1-beta (EF-1-beta) (Elongation factor| 1B-alpha 2) (eEF-1B alpha) (Elongation factor 1-beta') (EF-1-beta') Length = 215 Score = 58.9 bits (141), Expect = 3e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = +3 Query: 6 LDDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 +DDL S T IEEVLCEAPINEYVQSCDIVAFNKI Sbjct: 183 IDDLAS--TPIEEVLCEAPINEYVQSCDIVAFNKI 215
>EF1D_BETVU (O81918) Elongation factor 1-delta (EF-1-delta) (Elongation factor| 1B-beta) (eEF-1B beta) Length = 230 Score = 58.2 bits (139), Expect = 5e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = +3 Query: 6 LDDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 +DDLVSVD LIE+ L PINEYVQSCDIVAFNKI Sbjct: 196 VDDLVSVDNLIEDYLTVEPINEYVQSCDIVAFNKI 230
>EF1D_PIMBR (P93447) Elongation factor 1-delta (EF-1-delta) (Elongation factor| 1B-beta) (eEF-1B beta) Length = 225 Score = 55.5 bits (132), Expect = 3e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 6 LDDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 +DDLVSVD L+E+ L P NEY+QSCDIVAFNKI Sbjct: 191 VDDLVSVDDLVEDYLTAEPANEYIQSCDIVAFNKI 225
>EF1D1_ORYSA (Q40680) Elongation factor 1-delta 1 (EF-1-delta 1) (Elongation| factor 1B-beta 1) (eEF-1B beta 1) Length = 228 Score = 54.7 bits (130), Expect = 6e-08 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +3 Query: 6 LDDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 +DDLVSVD+LIE+ P NEY+QSCDIVAFNKI Sbjct: 194 VDDLVSVDSLIEDYFYTEPANEYIQSCDIVAFNKI 228
>EF1B2_ARATH (Q9SCX3) Elongation factor 1-beta 2 (EF-1-beta 2) (Elongation| factor 1B-alpha 2) (eEF-1B alpha 2) (Elongation factor 1-beta' 2) (EF-1-beta' 2) Length = 224 Score = 53.5 bits (127), Expect = 1e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 6 LDDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 +DDLVS D LIE+ L P NEY+QSCDIVAFNKI Sbjct: 190 VDDLVSPDNLIEDFLTSEPNNEYIQSCDIVAFNKI 224
>EF1D2_ORYSA (Q40682) Elongation factor 1-delta 2 (EF-1-delta 2) (Elongation| factor 1B-beta 2) (eEF-1B beta 2) Length = 225 Score = 53.1 bits (126), Expect = 2e-07 Identities = 24/35 (68%), Positives = 29/35 (82%) Frame = +3 Query: 6 LDDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 +DDLVSVD+LIE+ P NE++QSCDIVAFNKI Sbjct: 191 VDDLVSVDSLIEDYFYTEPANEFIQSCDIVAFNKI 225
>EF1B1_ARATH (Q84WM9) Elongation factor 1-beta 1 (EF-1-beta 1) (Elongation| factor 1B-alpha 1) (eEF-1B alpha 1) (Elongation factor 1-beta' 1) (EF-1-beta' 1) Length = 228 Score = 51.2 bits (121), Expect = 6e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +3 Query: 6 LDDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 +DDLVSVD LIE+ L P NEY+QS DIVAFNKI Sbjct: 194 VDDLVSVDNLIEDHLTSEPNNEYIQSVDIVAFNKI 228
>EF1D_ARTSA (P32192) Elongation factor 1-delta (EF-1-delta)| Length = 237 Score = 36.6 bits (83), Expect = 0.016 Identities = 19/34 (55%), Positives = 23/34 (67%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD VSVD L+E++ +YVQS DI AFNKI Sbjct: 207 DDKVSVDELVEKI---EAFEDYVQSVDIAAFNKI 237
>EF1D_DROME (Q9VL18) Probable elongation factor 1-delta (EF-1-delta)| Length = 256 Score = 35.0 bits (79), Expect = 0.046 Identities = 18/34 (52%), Positives = 23/34 (67%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD VS+D L EE+ + ++VQS DI AFNKI Sbjct: 226 DDKVSIDWLTEEI---EKLEDFVQSVDIAAFNKI 256
>EF1B1_CAEEL (P34460) Probable elongation factor 1-beta/1-delta 1| (EF-1-beta/delta 1) Length = 213 Score = 33.9 bits (76), Expect = 0.10 Identities = 20/36 (55%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +3 Query: 6 LDDL-VSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 ++DL VSVD LIE++ + ++VQS DIVAFNKI Sbjct: 180 IEDLKVSVDDLIEKITGD--FEDHVQSVDIVAFNKI 213
>EF1B2_CAEEL (Q9U2H9) Probable elongation factor 1-beta/1-delta 2| (EF-1-beta/delta 2) Length = 262 Score = 33.9 bits (76), Expect = 0.10 Identities = 20/36 (55%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +3 Query: 6 LDDL-VSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 ++DL VSVD LIE++ + ++VQS DIVAFNKI Sbjct: 229 IEDLKVSVDDLIEKITGD--FEDHVQSVDIVAFNKI 262
>EF1B2_BOMMO (P29522) Elongation factor 1-beta'| Length = 221 Score = 33.5 bits (75), Expect = 0.13 Identities = 18/34 (52%), Positives = 22/34 (64%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD VSVD L E++ ++VQS DI AFNKI Sbjct: 191 DDKVSVDLLTEKI---QEFEDFVQSVDIAAFNKI 221
>EF1B_BOVIN (Q5E983) Elongation factor 1-beta (EF-1-beta)| Length = 224 Score = 33.1 bits (74), Expect = 0.18 Identities = 17/34 (50%), Positives = 21/34 (61%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD V D L E++ +EYVQS D+ AFNKI Sbjct: 194 DDKVGTDMLEEQITA---FDEYVQSMDVAAFNKI 224
>EF1D_XENLA (P29693) Elongation factor 1-delta (EF-1-delta) (P36)| Length = 265 Score = 33.1 bits (74), Expect = 0.18 Identities = 18/34 (52%), Positives = 20/34 (58%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD V D L EE+ +YVQS DI AFNKI Sbjct: 235 DDKVGTDILEEEI---TKFEDYVQSVDIAAFNKI 265
>EF1B_ARTSA (P12262) Elongation factor 1-beta (EF-1-beta)| Length = 206 Score = 32.7 bits (73), Expect = 0.23 Identities = 16/34 (47%), Positives = 23/34 (67%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD VS+D L E++ + ++VQS DI AFNK+ Sbjct: 176 DDKVSIDELQEKI---SEFEDFVQSVDIAAFNKV 206
>EF1D_RABIT (P53787) Elongation factor 1-delta (EF-1-delta)| Length = 280 Score = 32.3 bits (72), Expect = 0.30 Identities = 18/34 (52%), Positives = 20/34 (58%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD V D L EE+ E+VQS DI AFNKI Sbjct: 250 DDKVGTDLLEEEI---TKFEEHVQSVDIAAFNKI 280
>EF1D_HUMAN (P29692) Elongation factor 1-delta (EF-1-delta) (Antigen NY-CO-4)| Length = 280 Score = 32.3 bits (72), Expect = 0.30 Identities = 18/34 (52%), Positives = 20/34 (58%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD V D L EE+ E+VQS DI AFNKI Sbjct: 250 DDKVGTDLLEEEI---TKFEEHVQSVDIAAFNKI 280
>EF1B_DROME (O96827) Probable elongation factor 1-beta (EF-1-beta)| Length = 221 Score = 32.3 bits (72), Expect = 0.30 Identities = 17/34 (50%), Positives = 22/34 (64%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD VS+D L E++ ++VQS DI AFNKI Sbjct: 191 DDKVSIDLLQEKI---EEFEDFVQSVDIAAFNKI 221
>EF1B_RABIT (P34826) Elongation factor 1-beta (EF-1-beta)| Length = 224 Score = 31.6 bits (70), Expect = 0.51 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD V D L E++ +YVQS D+ AFNKI Sbjct: 194 DDKVGTDMLEEQITA---FEDYVQSMDVAAFNKI 224
>EF1B_PIG (P29412) Elongation factor 1-beta (EF-1-beta)| Length = 224 Score = 31.6 bits (70), Expect = 0.51 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD V D L E++ +YVQS D+ AFNKI Sbjct: 194 DDKVGTDMLEEQITA---FEDYVQSMDVAAFNKI 224
>EF1B_MOUSE (O70251) Elongation factor 1-beta (EF-1-beta)| Length = 224 Score = 31.6 bits (70), Expect = 0.51 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD V D L E++ +YVQS D+ AFNKI Sbjct: 194 DDKVGTDMLEEQITA---FEDYVQSMDVAAFNKI 224
>EF1B_HUMAN (P24534) Elongation factor 1-beta (EF-1-beta)| Length = 224 Score = 31.6 bits (70), Expect = 0.51 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD V D L E++ +YVQS D+ AFNKI Sbjct: 194 DDKVGTDMLEEQITA---FEDYVQSMDVAAFNKI 224
>EF1B_CHICK (Q9YGQ1) Elongation factor 1-beta (EF-1-beta)| Length = 224 Score = 31.6 bits (70), Expect = 0.51 Identities = 16/34 (47%), Positives = 20/34 (58%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD V D L E++ +YVQS D+ AFNKI Sbjct: 194 DDKVGTDMLEEQITA---FEDYVQSMDVAAFNKI 224
>ALG9_MOUSE (Q8VDI9) Alpha-1,2-mannosyltransferase ALG9 (EC 2.4.1.-)| (Asparagine-linked glycosylation protein 9 homolog) (Disrupted in bipolar disorder protein 1 homolog) Length = 611 Score = 31.6 bits (70), Expect = 0.51 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 145 FLVLGLVCLCRPI*LPLLQKCYWFCF 222 F V L+CLC + L LQKCY F F Sbjct: 373 FPVYPLICLCGAVALSALQKCYHFVF 398
>ALG9_HUMAN (Q9H6U8) Alpha-1,2-mannosyltransferase ALG9 (EC 2.4.1.-)| (Asparagine-linked glycosylation protein 9 homolog) (Disrupted in bipolar disorder protein 1) Length = 611 Score = 31.6 bits (70), Expect = 0.51 Identities = 14/26 (53%), Positives = 16/26 (61%) Frame = +1 Query: 145 FLVLGLVCLCRPI*LPLLQKCYWFCF 222 F V L+CLC + L LQKCY F F Sbjct: 373 FPVYPLICLCGAVALSALQKCYHFVF 398
>EF1D_MOUSE (P57776) Elongation factor 1-delta (EF-1-delta)| Length = 280 Score = 30.4 bits (67), Expect = 1.1 Identities = 17/34 (50%), Positives = 20/34 (58%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD V D L EE+ E+VQS DI AF+KI Sbjct: 250 DDKVGTDLLEEEI---TKFEEHVQSVDIAAFDKI 280
>EF1B_XENLA (P30151) Elongation factor 1-beta (EF-1-beta) (p30)| Length = 226 Score = 30.0 bits (66), Expect = 1.5 Identities = 15/34 (44%), Positives = 20/34 (58%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD V D L E++ ++VQS D+ AFNKI Sbjct: 196 DDKVGTDVLEEKITA---FEDFVQSMDVAAFNKI 226
>EF1B_XENTR (Q6DET9) Elongation factor 1-beta (EF-1-beta)| Length = 227 Score = 29.6 bits (65), Expect = 1.9 Identities = 15/34 (44%), Positives = 19/34 (55%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI 110 DD V D L E + ++VQS D+ AFNKI Sbjct: 197 DDKVGTDVLEENITA---FEDFVQSMDVAAFNKI 227
>AP1G1_MOUSE (P22892) AP-1 complex subunit gamma-1 (Adapter-related protein| complex 1 gamma-1 subunit) (Gamma-adaptin) (Adaptor protein complex AP-1 gamma-1 subunit) (Golgi adaptor HA1/AP1 adaptin subunit gamma-1) (Clathrin assembly protein complex 1 gamm Length = 821 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 167 QTNPSTKNPAATGERTKILDLVEGNDVT 84 +T P P T + +LDL+ GND+T Sbjct: 610 ETKPPPSGPQPTSQANDLLDLLGGNDIT 637
>AP1G1_HUMAN (O43747) AP-1 complex subunit gamma-1 (Adapter-related protein| complex 1 gamma-1 subunit) (Gamma-adaptin) (Adaptor protein complex AP-1 gamma-1 subunit) (Golgi adaptor HA1/AP1 adaptin subunit gamma-1) (Clathrin assembly protein complex 1 gamm Length = 821 Score = 28.9 bits (63), Expect = 3.3 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 167 QTNPSTKNPAATGERTKILDLVEGNDVT 84 +T P P T + +LDL+ GND+T Sbjct: 610 ETKPPPSGPQPTSQANDLLDLLGGNDIT 637
>YZ2T_AGRVI (O34299) Hypothetical protein in TAR-II ttuC' 3'region (ORFZ2)| (Fragment) Length = 242 Score = 27.7 bits (60), Expect = 7.4 Identities = 11/19 (57%), Positives = 15/19 (78%) Frame = +1 Query: 115 IFVRSPVAAGFLVLGLVCL 171 +FV +P+AA L LGLVC+ Sbjct: 204 VFVTNPIAASLLGLGLVCV 222
>TMOD3_MOUSE (Q9JHJ0) Tropomodulin-3 (Ubiquitous tropomodulin) (U-Tmod)| Length = 352 Score = 27.3 bits (59), Expect = 9.7 Identities = 17/54 (31%), Positives = 28/54 (51%) Frame = +3 Query: 9 DDLVSVDTLIEEVLCEAPINEYVQSCDIVAFNKI*NLCPLTCCCWILGTGIGLS 170 ++ +S+D +EE L A E CD+ A + NL T C +LG+ G++ Sbjct: 110 EETISLDPELEEALTSASDTEL---CDLAAILGMHNLIADTPFCDVLGSSNGVN 160 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 39,445,448 Number of Sequences: 219361 Number of extensions: 605024 Number of successful extensions: 1553 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 1536 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1551 length of database: 80,573,946 effective HSP length: 88 effective length of database: 61,270,178 effective search space used: 1470484272 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
