| Clone Name | bags22k03 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TNR1A_MOUSE (P25118) Tumor necrosis factor receptor superfamily ... | 29 | 3.1 | 2 | GP152_MOUSE (Q8BXS7) Probable G-protein coupled receptor 152 | 29 | 3.1 | 3 | UNC89_CAEEL (O01761) Muscle M-line assembly protein unc-89 (Unco... | 28 | 4.1 | 4 | MTA3_MOUSE (Q924K8) Metastasis-associated protein MTA3 | 28 | 4.1 | 5 | YG2O_YEAST (P53257) Putative mitochondrial carrier YGR096W | 28 | 5.3 |
|---|
>TNR1A_MOUSE (P25118) Tumor necrosis factor receptor superfamily member 1A| precursor (p60) (TNF-R1) (TNF-RI) (TNFR-I) (p55) Length = 454 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/35 (42%), Positives = 21/35 (60%) Frame = -2 Query: 387 KKEELGEPNYLTRFPAPAFGDRSFMNPHVSPDSPG 283 K+E+ G+P LT P+PAF S NP + +PG Sbjct: 256 KEEKAGKP--LTPAPSPAFSPTSGFNPTLGFSTPG 288
>GP152_MOUSE (Q8BXS7) Probable G-protein coupled receptor 152| Length = 511 Score = 28.9 bits (63), Expect = 3.1 Identities = 15/38 (39%), Positives = 20/38 (52%) Frame = -2 Query: 393 QEKKEELGEPNYLTRFPAPAFGDRSFMNPHVSPDSPGP 280 Q + + + +P T P PAFGD S NP +S GP Sbjct: 438 QPQLDPVAQPQSNTETPIPAFGDESASNPG-EENSSGP 474
>UNC89_CAEEL (O01761) Muscle M-line assembly protein unc-89 (Uncoordinated protein| 89) Length = 8081 Score = 28.5 bits (62), Expect = 4.1 Identities = 24/73 (32%), Positives = 29/73 (39%) Frame = +2 Query: 161 EKKPAVTEKKPAVANGAVKTGVAA*SHTRSSQLAMRNKRNGPGESGETCGFMKERSPKAG 340 EK P TE+KP A+ KTG S S + K P KE+SP + Sbjct: 1383 EKSPEKTEEKP--ASPTKKTGEEVKSPKEKSPASPTKKEKSPAAEEVKSPTKKEKSPSSP 1440 Query: 341 AGKRVR*LGSPSS 379 K SPSS Sbjct: 1441 TKKE----KSPSS 1449
>MTA3_MOUSE (Q924K8) Metastasis-associated protein MTA3| Length = 591 Score = 28.5 bits (62), Expect = 4.1 Identities = 17/45 (37%), Positives = 22/45 (48%) Frame = +2 Query: 164 KKPAVTEKKPAVANGAVKTGVAA*SHTRSSQLAMRNKRNGPGESG 298 KKP V P++ A K +AA +HT S L RN + G G Sbjct: 540 KKPNVIRSPPSLQTPATKRMLAAPNHTSLSILGKRNYSHHNGLDG 584
>YG2O_YEAST (P53257) Putative mitochondrial carrier YGR096W| Length = 314 Score = 28.1 bits (61), Expect = 5.3 Identities = 13/36 (36%), Positives = 21/36 (58%), Gaps = 3/36 (8%) Frame = -1 Query: 118 WRTSSRG---GFLCRNLHAPVDTVRYRRLRLPIDGM 20 W+T G G L R++ AP+DT++ R P +G+ Sbjct: 17 WKTLLAGAVSGLLARSITAPMDTIKIRLQLTPANGL 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 47,088,211 Number of Sequences: 219361 Number of extensions: 726876 Number of successful extensions: 1604 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1576 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1604 length of database: 80,573,946 effective HSP length: 106 effective length of database: 57,321,680 effective search space used: 1375720320 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)