| Clone Name | bags22e20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TRPD_BACSK (Q5WGS4) Anthranilate phosphoribosyltransferase (EC 2... | 29 | 3.7 | 2 | LOXL2_PONPY (Q5RFQ6) Lysyl oxidase homolog 2 precursor (EC 1.4.3... | 28 | 8.3 |
|---|
>TRPD_BACSK (Q5WGS4) Anthranilate phosphoribosyltransferase (EC 2.4.2.18)| Length = 341 Score = 28.9 bits (63), Expect = 3.7 Identities = 13/27 (48%), Positives = 17/27 (62%) Frame = -3 Query: 186 DVHLCDPRPGRAHAETARFGTDDIGLP 106 D H+ + + GR ET RF DD+GLP Sbjct: 232 DTHVVEVKDGRC--ETYRFSPDDVGLP 256
>LOXL2_PONPY (Q5RFQ6) Lysyl oxidase homolog 2 precursor (EC 1.4.3.-) (Lysyl| oxidase-like protein 2) Length = 774 Score = 27.7 bits (60), Expect = 8.3 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 3/33 (9%) Frame = -1 Query: 221 LVQCRSRPDGH--WMCTCVI-RDLVEHTPKQLG 132 +++CRSR DGH WM C I E T K+ G Sbjct: 729 IMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFG 761 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 34,914,774 Number of Sequences: 219361 Number of extensions: 620134 Number of successful extensions: 1637 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1637 length of database: 80,573,946 effective HSP length: 52 effective length of database: 69,167,174 effective search space used: 1660012176 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)