| Clone Name | bags22c20 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YG41_SCHPO (O60176) Hypothetical RNA-binding protein C23E6.01c i... | 31 | 1.1 | 2 | CSX1_SCHPO (O13759) RNA-binding post-transcriptional regulator csx1 | 29 | 3.1 | 3 | DPP4_RAT (P14740) Dipeptidyl peptidase 4 (EC 3.4.14.5) (Dipeptid... | 28 | 9.2 |
|---|
>YG41_SCHPO (O60176) Hypothetical RNA-binding protein C23E6.01c in chromosome| II Length = 473 Score = 30.8 bits (68), Expect = 1.1 Identities = 16/32 (50%), Positives = 21/32 (65%), Gaps = 1/32 (3%) Frame = +1 Query: 46 MPNTDRAFKLNWAS-YSVGEKRSELASDHSIF 138 +P T+ FKLNWAS + EK AS++SIF Sbjct: 158 IPGTNHLFKLNWASGGGLREKSISKASEYSIF 189
>CSX1_SCHPO (O13759) RNA-binding post-transcriptional regulator csx1| Length = 632 Score = 29.3 bits (64), Expect = 3.1 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +1 Query: 4 AXAEKALQNFAGHVMPNTDRAFKLNWAS 87 A AE+AL + ++P FKLNWA+ Sbjct: 139 AAAERALMKYNNTMIPGAHCTFKLNWAT 166
>DPP4_RAT (P14740) Dipeptidyl peptidase 4 (EC 3.4.14.5) (Dipeptidyl peptidase| IV) (DPP IV) (T-cell activation antigen CD26) (GP110 glycoprotein) (Bile canaliculus domain-specific membrane glycoprotein) [Contains: Dipeptidyl peptidase 4 membrane form (Dipe Length = 767 Score = 27.7 bits (60), Expect = 9.2 Identities = 12/31 (38%), Positives = 17/31 (54%) Frame = +1 Query: 31 FAGHVMPNTDRAFKLNWASYSVGEKRSELAS 123 +AG D AF+LNWA+Y + +AS Sbjct: 548 YAGPCSQKADAAFRLNWATYLASTENIIVAS 578 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.316 0.126 0.373 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 13,738,279 Number of Sequences: 219361 Number of extensions: 121472 Number of successful extensions: 251 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 251 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 251 length of database: 80,573,946 effective HSP length: 21 effective length of database: 75,967,365 effective search space used: 1823216760 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)