| Clone Name | bags21m02 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | YMM1_CAEEL (P34489) Hypothetical protein K01B6.1 | 35 | 0.25 |
|---|
>YMM1_CAEEL (P34489) Hypothetical protein K01B6.1| Length = 732 Score = 34.7 bits (78), Expect = 0.25 Identities = 22/84 (26%), Positives = 42/84 (50%), Gaps = 4/84 (4%) Frame = +2 Query: 272 EHELLFCISVHERKHSDDHTLQKLEVG--LSFAPAITLSNMDAEILF*YHYVNYFLF*RN 445 +++LL + H+++ + H L+ L S PA+ +N + +L +VN FL + Sbjct: 270 QNDLLATLQQHQQQQAAFHPLRNLRFNPLQSIFPAVLANNNNNSVLATNKHVNNFLIKQE 329 Query: 446 VAEAPP--LHYGEIKVLLQKNKLP 511 +E PP + ++K +L N P Sbjct: 330 ESEVPPITMPMQDLKTMLDANSSP 353 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,673,500 Number of Sequences: 219361 Number of extensions: 1742985 Number of successful extensions: 3204 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 3128 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3204 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5995743495 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)