| Clone Name | bags21l05 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | MYO10_BOVIN (P79114) Myosin-10 (Myosin X) | 30 | 5.2 | 2 | GLMM_PSEPK (Q88DV3) Phosphoglucosamine mutase (EC 5.4.2.10) | 30 | 5.2 | 3 | MYO10_HUMAN (Q9HD67) Myosin-10 (Myosin X) | 30 | 5.2 |
|---|
>MYO10_BOVIN (P79114) Myosin-10 (Myosin X)| Length = 2052 Score = 29.6 bits (65), Expect = 5.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 350 PLPRADGHISYGGALRPGEGDAIAQYVQQGKRIPRRGEVG 469 P+P G + G LRP + Q ++Q ++P G VG Sbjct: 1579 PIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVG 1618
>GLMM_PSEPK (Q88DV3) Phosphoglucosamine mutase (EC 5.4.2.10)| Length = 446 Score = 29.6 bits (65), Expect = 5.2 Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 9/77 (11%) Frame = +2 Query: 284 FKEMLEAQKKAALENEMPVGPMPLP---------RADGHISYGGALRPGEGDAIAQYVQQ 436 F+ LEA AA + M +GPMP P A+ I + P + + I + Q Sbjct: 57 FESALEAGLSAAGADVMLLGPMPTPAIAYLTRTFHAEAGIVISASHNPHDDNGIKFFSGQ 116 Query: 437 GKRIPRRGEVGLSADEI 487 G ++P EV L +E+ Sbjct: 117 GTKLP--DEVELMIEEL 131
>MYO10_HUMAN (Q9HD67) Myosin-10 (Myosin X)| Length = 2058 Score = 29.6 bits (65), Expect = 5.2 Identities = 13/40 (32%), Positives = 20/40 (50%) Frame = +2 Query: 350 PLPRADGHISYGGALRPGEGDAIAQYVQQGKRIPRRGEVG 469 P+P G + G LRP + Q ++Q ++P G VG Sbjct: 1585 PIPIIQGILQTGHDLRPLRDELYCQLIKQTNKVPHPGSVG 1624 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 48,349,688 Number of Sequences: 219361 Number of extensions: 764308 Number of successful extensions: 2054 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2025 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2053 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3927707336 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)