| Clone Name | bags21j24 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | AMPP_HAEIN (P44881) Xaa-Pro aminopeptidase (EC 3.4.11.9) (X-Pro ... | 30 | 4.0 | 2 | VL1_PAPVD (P03104) Major capsid protein L1 | 30 | 5.3 | 3 | PAIN_DROME (Q9W0Y6) Transient receptor potential cation channel ... | 30 | 5.3 | 4 | GCSPB_PYRFU (Q8TZJ2) Probable glycine dehydrogenase [decarboxyla... | 29 | 6.9 |
|---|
>AMPP_HAEIN (P44881) Xaa-Pro aminopeptidase (EC 3.4.11.9) (X-Pro| aminopeptidase) (Aminopeptidase P II) (APP-II) (Aminoacylproline aminopeptidase) Length = 430 Score = 30.0 bits (66), Expect = 4.0 Identities = 21/79 (26%), Positives = 36/79 (45%), Gaps = 5/79 (6%) Frame = +1 Query: 124 TWRGRQLDVDADPRCTIKEFGQLLQDLTNVKPETLKLI-----VPQSANKGSKLISPFSD 288 TW GR+L V+ P+ +++ V P+ LK + VP+ G L+S + Sbjct: 92 TWNGRRLGVERAPQQLNVNEAYSIEEFATVLPKILKNLTALYHVPEIHTWGDTLVSESAV 151 Query: 289 THSSLTLKEAAISEGKLIR 345 S + +SE +LI+ Sbjct: 152 NFSEILDWRPMLSEMRLIK 170
>VL1_PAPVD (P03104) Major capsid protein L1| Length = 513 Score = 29.6 bits (65), Expect = 5.3 Identities = 16/56 (28%), Positives = 29/56 (51%) Frame = -1 Query: 264 GTFVCRLRNYELQRLWFNISQILEQLPKFLDRTSWVCINVKLPASPSDRYSSYSLF 97 G+ L N+E+ L S +LE + +F+D + C + P+ P D YS++ + Sbjct: 391 GSMPSILENWEIN-LQPPTSSVLEDIYRFIDSPATKCADNVSPSKPEDPYSAHKFW 445
>PAIN_DROME (Q9W0Y6) Transient receptor potential cation channel protein| painless Length = 913 Score = 29.6 bits (65), Expect = 5.3 Identities = 17/51 (33%), Positives = 26/51 (50%), Gaps = 1/51 (1%) Frame = +1 Query: 181 FGQLLQDLTNVKPETLKLI-VPQSANKGSKLISPFSDTHSSLTLKEAAISE 330 F + Q L N+ P L L + N G+K++ P SD TLK+A+ + Sbjct: 779 FRSICQRLMNIYPNYLSLRQISVLPNDGNKVLIPMSDPFEMRTLKKASFQQ 829
>GCSPB_PYRFU (Q8TZJ2) Probable glycine dehydrogenase [decarboxylating] subunit 2| (EC 1.4.4.2) (Glycine decarboxylase subunit 2) (Glycine cleavage system P-protein subunit 2) Length = 502 Score = 29.3 bits (64), Expect = 6.9 Identities = 24/78 (30%), Positives = 43/78 (55%), Gaps = 17/78 (21%) Frame = +1 Query: 202 LTNVKPETLKLIVPQSAN---------KGSKLISPFSDTHSSLTLK--EAAISE---GKL 339 L N +P+ +++VP SA+ G K+I S+ + ++ L+ E A+SE G + Sbjct: 156 LDNGEPQRNEMLVPDSAHGTNPASAAMAGFKVIEIPSNENGTIDLEALENAVSERTAGLM 215 Query: 340 I---RMMGVFEDEIEEVS 384 + +G+FEDEI E++ Sbjct: 216 LTNPNTLGIFEDEIVEIA 233 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,458,586 Number of Sequences: 219361 Number of extensions: 1202722 Number of successful extensions: 3335 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3335 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 3970331829 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)