| Clone Name | bags21g15 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TIMD3_HUMAN (Q8TDQ0) Hepatitis A virus cellular receptor 2 precu... | 39 | 0.010 | 2 | GNT1_GIBZE (Q4HVS2) Glucose N-acetyltransferase 1 (EC 2.4.1.-) (... | 31 | 3.6 | 3 | CBPA1_DROPS (Q29NC4) Zinc carboxypeptidase A 1 precursor (EC 3.4... | 31 | 3.6 | 4 | CING_XENLA (Q9PTD7) Cingulin | 30 | 8.1 | 5 | MYCD_RAT (Q8R5I7) Myocardin | 30 | 8.1 | 6 | MYCD_MOUSE (Q8VIM5) Myocardin (SRF cofactor protein) (Basic SAP ... | 30 | 8.1 |
|---|
>TIMD3_HUMAN (Q8TDQ0) Hepatitis A virus cellular receptor 2 precursor (HAVcr-2)| (T cell immunoglobulin and mucin domain-containing protein 3) (TIMD-3) (T cell membrane protein 3) (TIM-3) Length = 301 Score = 39.3 bits (90), Expect = 0.010 Identities = 23/75 (30%), Positives = 41/75 (54%) Frame = +3 Query: 141 MITGKLLIRALMHSNTLFREFSLISMRRVPDLPVGPHKLLAILAEPLKQKENLFSLEDQE 320 +I G L+ + HS + SLIS+ +P P L +AE ++ +EN++++E Sbjct: 217 LIFGALIFKWYSHSKEKIQNLSLISLANLP-----PSGLANAVAEGIRSEENIYTIE--- 268 Query: 321 VSDNLEEFEDWHEYY 365 +N+ E E+ +EYY Sbjct: 269 --ENVYEVEEPNEYY 281
>GNT1_GIBZE (Q4HVS2) Glucose N-acetyltransferase 1 (EC 2.4.1.-)| (N-acetylglucosaminyltransferase) Length = 431 Score = 30.8 bits (68), Expect = 3.6 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 3/47 (6%) Frame = +3 Query: 228 PDLPVGPHKLLAILAEPLKQKENLFSLEDQEVSD---NLEEFEDWHE 359 PD PHKL E L+ K ED++ D NL++ DW E Sbjct: 68 PDSRPTPHKLTIAEIEDLENKGEFMGFEDEDEIDVFINLDDDGDWEE 114
>CBPA1_DROPS (Q29NC4) Zinc carboxypeptidase A 1 precursor (EC 3.4.17.-)| Length = 425 Score = 30.8 bits (68), Expect = 3.6 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 13/66 (19%) Frame = +3 Query: 240 VGPHKLLAILAEPLKQKENLFSLEDQEVSDNLEEFED-------------WHEYYSLDAT 380 V PHK+ +L E L + E + L+ +V ++E ++ W +YY LD T Sbjct: 73 VAPHKVPDLL-EILGKAEIKYLLQSSDVQKTMDEIDEKVAMKGRAGEAYNWAQYYELDDT 131 Query: 381 YRGWLR 398 Y WL+ Sbjct: 132 Y-AWLQ 136
>CING_XENLA (Q9PTD7) Cingulin| Length = 1360 Score = 29.6 bits (65), Expect = 8.1 Identities = 21/76 (27%), Positives = 38/76 (50%) Frame = +3 Query: 114 PPSSIPGFEMITGKLLIRALMHSNTLFREFSLISMRRVPDLPVGPHKLLAILAEPLKQKE 293 P S P EMI G L +L NTL ++ S++ + ++P L V P + L K+ E Sbjct: 384 PDGSDPTREMIFGILREGSLESENTLRKKTSIL-LEKLPSLQVQPGEDTISLGSQKKELE 442 Query: 294 NLFSLEDQEVSDNLEE 341 + +++ D +++ Sbjct: 443 RKVAELQRQLDDEMKQ 458
>MYCD_RAT (Q8R5I7) Myocardin| Length = 938 Score = 29.6 bits (65), Expect = 8.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 93 IQWLCFTPPSSIPGFEMIT 149 ++WL TPPSS PGF +T Sbjct: 890 MEWLDLTPPSSTPGFSNLT 908
>MYCD_MOUSE (Q8VIM5) Myocardin (SRF cofactor protein) (Basic SAP coiled-coil| transcription activator 2) Length = 935 Score = 29.6 bits (65), Expect = 8.1 Identities = 11/19 (57%), Positives = 14/19 (73%) Frame = +3 Query: 93 IQWLCFTPPSSIPGFEMIT 149 ++WL TPPSS PGF +T Sbjct: 887 MEWLDLTPPSSTPGFSNLT 905 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 89,068,955 Number of Sequences: 219361 Number of extensions: 1770868 Number of successful extensions: 4479 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 4383 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4479 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6143359464 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)