| Clone Name | bags21g08 |
|---|---|
| Clone Library Name | barley_pub |
>AROK_PYRKO (Q5JFT2) Shikimate kinase (EC 2.7.1.71) (SK)| Length = 271 Score = 31.6 bits (70), Expect = 2.2 Identities = 21/79 (26%), Positives = 39/79 (49%) Frame = +1 Query: 214 LIRNLAHYFSRRANWEFSARNSLAISSTPLLIKARKESCSFSSLRK*LLYSNCVDMKPLT 393 L++ +A F + EF + + S P+ + + S + ++L K L + +DM + Sbjct: 56 LVKAVADVFREKTGEEFGIKFRIE-SEIPIAMGLKSSSAAANALSKALADALGLDMSEME 114 Query: 394 LVSISSNFAKRASKSLSGA 450 +V AKRA +L+GA Sbjct: 115 VVKAGVEAAKRAGVTLTGA 133
>Y101_ARCFU (O30135) Hypothetical protein AF0101| Length = 216 Score = 30.4 bits (67), Expect = 4.9 Identities = 20/69 (28%), Positives = 35/69 (50%), Gaps = 7/69 (10%) Frame = -2 Query: 560 FTNLPFSFTFFVRLFVR--PFSRPLFVCLCACLPARARMAPLRD-----FDARFAKLEEI 402 F NLP S+T++V F + P + L + C+ A + PLR+ D ++ K+ +I Sbjct: 28 FINLPSSYTYYVTSFDKKLPKNVTLIIPTCSLNGDIAEIKPLREGNISLLDTQYGKMIKI 87 Query: 401 ETSVKGFMS 375 E G ++ Sbjct: 88 EAEEVGHIT 96
>OPGD_SALTY (Q8ZPB3) Glucans biosynthesis protein D precursor| Length = 551 Score = 29.6 bits (65), Expect = 8.3 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 4/24 (16%) Frame = -1 Query: 165 ENH----EDLKVLGVAPIESLFSC 106 ENH +D+K LG+AP+ S+FSC Sbjct: 260 ENHLYARKDIKQLGIAPMTSMFSC 283
>OPGD_SALTI (Q8Z765) Glucans biosynthesis protein D precursor| Length = 551 Score = 29.6 bits (65), Expect = 8.3 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 4/24 (16%) Frame = -1 Query: 165 ENH----EDLKVLGVAPIESLFSC 106 ENH +D+K LG+AP+ S+FSC Sbjct: 260 ENHLYARKDIKQLGIAPMTSMFSC 283
>OPGD_ECOLI (P40120) Glucans biosynthesis protein D precursor| Length = 551 Score = 29.6 bits (65), Expect = 8.3 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 4/24 (16%) Frame = -1 Query: 165 ENH----EDLKVLGVAPIESLFSC 106 ENH +D+K LG+AP+ S+FSC Sbjct: 260 ENHLYARKDIKQLGIAPMTSMFSC 283
>OPGD_ECOL6 (Q8CW34) Glucans biosynthesis protein D precursor| Length = 551 Score = 29.6 bits (65), Expect = 8.3 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 4/24 (16%) Frame = -1 Query: 165 ENH----EDLKVLGVAPIESLFSC 106 ENH +D+K LG+AP+ S+FSC Sbjct: 260 ENHLYARKDIKQLGIAPMTSMFSC 283
>OPGD_ECO57 (Q8X9V1) Glucans biosynthesis protein D precursor| Length = 551 Score = 29.6 bits (65), Expect = 8.3 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 4/24 (16%) Frame = -1 Query: 165 ENH----EDLKVLGVAPIESLFSC 106 ENH +D+K LG+AP+ S+FSC Sbjct: 260 ENHLYARKDIKQLGIAPMTSMFSC 283 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 82,866,802 Number of Sequences: 219361 Number of extensions: 1487867 Number of successful extensions: 4576 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 4432 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4576 length of database: 80,573,946 effective HSP length: 108 effective length of database: 56,882,958 effective search space used: 6257125380 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)