| Clone Name | bags21b04 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | KLH12_RAT (Q8R2H4) Kelch-like protein 12 (CUL3-interacting prote... | 31 | 2.3 | 2 | KLH12_MOUSE (Q8BZM0) Kelch-like protein 12 (CUL3-interacting pro... | 31 | 2.3 | 3 | KLH12_HUMAN (Q53G59) Kelch-like protein 12 (CUL3-interacting pro... | 31 | 2.3 |
|---|
>KLH12_RAT (Q8R2H4) Kelch-like protein 12 (CUL3-interacting protein 1)| Length = 568 Score = 30.8 bits (68), Expect = 2.3 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +3 Query: 105 FLILETVGTILKNMM*YPPS*CITRKLNVNIERSIEFLSSIL*-CKCLGTSIFKHNHNTV 281 F+ ETV ++N+ P+ C+ + V + EFL S L CLG F HN V Sbjct: 90 FVYTETVHVTVENVQELLPAACLLQLKGVK-QACCEFLESQLDPSNCLGIRDFAETHNCV 148 Query: 282 DL 287 DL Sbjct: 149 DL 150
>KLH12_MOUSE (Q8BZM0) Kelch-like protein 12 (CUL3-interacting protein 1)| Length = 568 Score = 30.8 bits (68), Expect = 2.3 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +3 Query: 105 FLILETVGTILKNMM*YPPS*CITRKLNVNIERSIEFLSSIL*-CKCLGTSIFKHNHNTV 281 F+ ETV ++N+ P+ C+ + V + EFL S L CLG F HN V Sbjct: 90 FVYTETVHVTVENVQELLPAACLLQLKGVK-QACCEFLESQLDPSNCLGIRDFAETHNCV 148 Query: 282 DL 287 DL Sbjct: 149 DL 150
>KLH12_HUMAN (Q53G59) Kelch-like protein 12 (CUL3-interacting protein 1)| Length = 568 Score = 30.8 bits (68), Expect = 2.3 Identities = 22/62 (35%), Positives = 30/62 (48%), Gaps = 1/62 (1%) Frame = +3 Query: 105 FLILETVGTILKNMM*YPPS*CITRKLNVNIERSIEFLSSIL*-CKCLGTSIFKHNHNTV 281 F+ ETV ++N+ P+ C+ + V + EFL S L CLG F HN V Sbjct: 90 FVYTETVHVTVENVQELLPAACLLQLKGVK-QACCEFLESQLDPSNCLGIRDFAETHNCV 148 Query: 282 DL 287 DL Sbjct: 149 DL 150 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 62,712,766 Number of Sequences: 219361 Number of extensions: 1072559 Number of successful extensions: 2140 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2118 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2140 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3869946934 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)