| Clone Name | bags19o14 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | TGM1_RABIT (P22758) Protein-glutamine gamma-glutamyltransferase ... | 29 | 9.4 |
|---|
>TGM1_RABIT (P22758) Protein-glutamine gamma-glutamyltransferase K (EC| 2.3.2.13) (Transglutaminase K) (TGase K) (TGK) (TG(K)) (Transglutaminase-1) (Epidermal TGase) Length = 836 Score = 29.3 bits (64), Expect = 9.4 Identities = 16/66 (24%), Positives = 33/66 (50%), Gaps = 2/66 (3%) Frame = +3 Query: 21 QFEQAFVVTKMMTSKVYKRRLSEGAYKWPGMDILLKYVRNVDLHGVFLAGV--SHTRTCV 194 +++ F+ ++ + KVY +R +G++K + YV + + + SH R + Sbjct: 508 KYDTPFIFAEVNSDKVYWQRQDDGSFK-------IVYVEEKAIGTLIVTKAVRSHMREDI 560 Query: 195 SHTYKH 212 +H YKH Sbjct: 561 THIYKH 566 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 93,534,251 Number of Sequences: 219361 Number of extensions: 1946361 Number of successful extensions: 4877 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 4773 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4877 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5424720305 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)