>LGRB_BREPA (Q70LM6) Linear gramicidin synthetase subunit B [Includes:|
            ATP-dependent alanine adenylase (AlaA) (Alanine
            activase); ATP-dependent D-leucine adenylase (D-LeuA)
            (D-leucine activase); Leucine racemase [ATP-hydrolyzing]
            (EC 5.1.1.-); ATP-depende
          Length = 5162

 Score = 30.0 bits (66), Expect = 6.9
 Identities = 16/52 (30%), Positives = 28/52 (53%)
 Frame = +3

Query: 156  GNLT*NLALSNGQKRIDMPILKKPKQSSVCIFW*MSGA*RSMMVLVKASIPR 311
            GNL   +A   GQK +++P+L   +QS + + W  +    S+ +LV   + R
Sbjct: 1477 GNLLQAIAADPGQKIVELPLLGGAEQSRMLVEWNQTDVAYSLDLLVHERVAR 1528


  Database: uniprot_sprot.fasta
    Posted date:  May 25, 2006  5:36 PM
  Number of letters in database: 80,573,946
  Number of sequences in database:  219,361
  
Lambda     K      H
   0.318    0.135    0.401 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 90,673,285
Number of Sequences: 219361
Number of extensions: 1754931
Number of successful extensions: 2555
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 2531
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 2555
length of database: 80,573,946
effective HSP length: 108
effective length of database: 56,882,958
effective search space used: 6769072002
frameshift window, decay const: 50,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)