ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags19l13 |
|---|---|
| Clone Library Name | barley_pub |
>HPBP1_RAT (Q6IMX7) Hsp70-binding protein 1 (HspBP1) (Heat shock| protein-binding protein 1) (Hsp70-interacting protein 1) Length = 357 Score = 30.8 bits (68), Expect = 3.4 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 424 QILGYGALARLVKMGYSTSAKEA-AKAMYAISALIRNNVNGEEEFALENGNAML 582 Q+LG GAL +L+++ S KA++AIS L+R G +F +G ++L Sbjct: 180 QVLGLGALRKLLRLLDRDSCDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVL 233
>HPBP1_MOUSE (Q99P31) Hsp70-binding protein 1 (HspBP1) (Heat shock| protein-binding protein 1) (Hsp70-interacting protein 1) Length = 357 Score = 30.8 bits (68), Expect = 3.4 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 424 QILGYGALARLVKMGYSTSAKEA-AKAMYAISALIRNNVNGEEEFALENGNAML 582 Q+LG GAL +L+++ S KA++AIS L+R G +F +G ++L Sbjct: 180 QVLGLGALRKLLRLLDRDSCDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVL 233
>UPPS_STAES (Q8CPG7) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 256 Score = 30.4 bits (67), Expect = 4.4 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -1 Query: 264 RNHYNGIAMVK*KIYKHHFQAYLVKLKRQIYSSIHWARPEQHINY 130 + HY G+ +K KI + + L +S+ +W+RPE +NY Sbjct: 48 KGHYEGMQTIK-KITREASDIGIKYLTLYAFSTENWSRPESEVNY 91
>UPPS_STAEQ (Q5HPT1) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 256 Score = 30.4 bits (67), Expect = 4.4 Identities = 14/45 (31%), Positives = 24/45 (53%) Frame = -1 Query: 264 RNHYNGIAMVK*KIYKHHFQAYLVKLKRQIYSSIHWARPEQHINY 130 + HY G+ +K KI + + L +S+ +W+RPE +NY Sbjct: 48 KGHYEGMQTIK-KITREASDIGIKYLTLYAFSTENWSRPESEVNY 91
>UPPS_STAS1 (Q49X45) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 254 Score = 30.4 bits (67), Expect = 4.4 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -1 Query: 264 RNHYNGIAMVK*KIYKHHFQAYLVKLKRQIYSSIHWARPEQHINY 130 + HY G+ VK KI K + L +S+ +W RPE +NY Sbjct: 49 KGHYQGMQTVK-KITKVASDIGIKYLTLYAFSTENWTRPENEVNY 92
>EYA3_MOUSE (P97480) Eyes absent homolog 3 (EC 3.1.3.48)| Length = 510 Score = 29.6 bits (65), Expect = 7.6 Identities = 13/37 (35%), Positives = 20/37 (54%), Gaps = 2/37 (5%) Frame = -1 Query: 444 SSITKNLTKKKTVSTC--YMARTKNDYNKYFNNRHPY 340 SS+ NL+ + + TC Y+ R+ NDY + PY Sbjct: 25 SSLASNLSMSEEIMTCTDYIPRSSNDYTSQMYSAKPY 61
>UPPS_MICLU (O82827) Undecaprenyl pyrophosphate synthetase (EC 2.5.1.31) (UPP| synthetase) (Di-trans,poly-cis-decaprenylcistransferase) (Undecaprenyl diphosphate synthase) (UDS) Length = 249 Score = 29.6 bits (65), Expect = 7.6 Identities = 14/45 (31%), Positives = 25/45 (55%) Frame = -1 Query: 264 RNHYNGIAMVK*KIYKHHFQAYLVKLKRQIYSSIHWARPEQHINY 130 + HY G+ VK KI ++ + L +S+ +W+RP+ +NY Sbjct: 44 KGHYEGMQTVK-KITRYASDLGVKYLTLYAFSTENWSRPKDEVNY 87
>HPBP1_MACFA (Q4R588) Hsp70-binding protein 1 (HspBP1) (Heat shock| protein-binding protein 1) (Hsp70-interacting protein 1) Length = 364 Score = 29.6 bits (65), Expect = 7.6 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 424 QILGYGALARLVKMGYSTSAKEA-AKAMYAISALIRNNVNGEEEFALENGNAML 582 Q+LG GAL +L+++ + KA++AIS L+R G +F +G ++L Sbjct: 187 QVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVL 240
>HPBP1_HUMAN (Q9NZL4) Hsp70-binding protein 1 (HspBP1) (Heat shock| protein-binding protein 1) (Hsp70-interacting protein 1) (Hsp70-binding protein 2) (HspBP2) (Hsp70-interacting protein 2) Length = 362 Score = 29.6 bits (65), Expect = 7.6 Identities = 18/54 (33%), Positives = 31/54 (57%), Gaps = 1/54 (1%) Frame = +1 Query: 424 QILGYGALARLVKMGYSTSAKEA-AKAMYAISALIRNNVNGEEEFALENGNAML 582 Q+LG GAL +L+++ + KA++AIS L+R G +F +G ++L Sbjct: 185 QVLGLGALRKLLRLLDRDACDTVRVKALFAISCLVREQEAGLLQFLRLDGFSVL 238
>CWC22_YEAST (P53333) Pre-mRNA-splicing factor CWC22 (Complexed with CEF1| protein 22) Length = 577 Score = 29.6 bits (65), Expect = 7.6 Identities = 19/41 (46%), Positives = 26/41 (63%) Frame = -2 Query: 389 LEQKMIITNTSTTDTPMGKHRRKLALNKMTCTVDNQFEKKI 267 L QK++I NTS DT G + +L + MT T D +F+KKI Sbjct: 258 LRQKLLINNTS--DTNEGSN-SQLQIYDMTSTNDVEFKKKI 295
>HMDH_SCHMA (P16237) 3-hydroxy-3-methylglutaryl-coenzyme A reductase (EC| 1.1.1.34) (HMG-CoA reductase) Length = 948 Score = 29.3 bits (64), Expect = 9.9 Identities = 22/92 (23%), Positives = 40/92 (43%), Gaps = 5/92 (5%) Frame = +3 Query: 75 NSIMQIWGVNFLFFVSNMCSLCVVQAWPNECYCKFVSLTSLNMLENDVYISFISPLLYHC 254 N + W F+ FVS ++ N Y + +S N EN+V+ P+LYH Sbjct: 281 NCHYKCWSTTFVIFVS------LIILHLNNRYSERISSFKHNSSENEVF-----PVLYHI 329 Query: 255 SGF-----FYFLFKLIVNCACHLIKSQFPSMF 335 + + F+F++ + +L+ F +F Sbjct: 330 TAYEVTSIFHFIYNIFHVINANLVVYLFLGLF 361 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 84,362,775 Number of Sequences: 219361 Number of extensions: 1624294 Number of successful extensions: 3819 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 3733 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3814 length of database: 80,573,946 effective HSP length: 107 effective length of database: 57,102,319 effective search space used: 5710231900 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
