| Clone Name | bags19j06 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | GML_HUMAN (Q99445) Glycosyl-phosphatidylinositol-anchored molecu... | 31 | 2.2 | 2 | SYNE2_HUMAN (Q8WXH0) Nesprin-2 (Nuclear envelope spectrin repeat... | 30 | 4.8 | 3 | CST11_RAT (Q8K5A3) Cystatin-11 precursor | 29 | 6.3 | 4 | FENR_CHLRE (P53991) Ferredoxin--NADP reductase, chloroplast prec... | 29 | 6.3 |
|---|
>GML_HUMAN (Q99445) Glycosyl-phosphatidylinositol-anchored molecule-like| protein precursor Length = 158 Score = 30.8 bits (68), Expect = 2.2 Identities = 16/42 (38%), Positives = 19/42 (45%) Frame = -3 Query: 494 YYNCTKNCTLQHNASHYKYHEGRIPFT*MSLRWSCTSSDSVC 369 Y NCT NCT + A G+I F S W C + VC Sbjct: 70 YKNCTNNCTFVYAAEQPPEAPGKI-FKTNSFYWVCCCNSMVC 110
>SYNE2_HUMAN (Q8WXH0) Nesprin-2 (Nuclear envelope spectrin repeat protein 2)| (Syne-2) (Synaptic nuclear envelope protein 2) (Nucleus and actin connecting element protein) (NUANCE protein) Length = 6885 Score = 29.6 bits (65), Expect = 4.8 Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 1/72 (1%) Frame = +1 Query: 199 STLDLFTRELEFRREMVAAFKSLVKERWESIHAAPVIVLPYEGD-DNSNKALPAKASRQT 375 +++DL T L E + +K V ESI + I++PY D N ++L +Q Sbjct: 3242 TSIDLRTNVLNDAYENLTRYKEAVTRAVESITSLEAIIIPYRVDVGNPEESLEMPLRKQE 3301 Query: 376 ESEDVQDQRSDI 411 E E D+ Sbjct: 3302 ELESTVAHIQDL 3313
>CST11_RAT (Q8K5A3) Cystatin-11 precursor| Length = 139 Score = 29.3 bits (64), Expect = 6.3 Identities = 13/49 (26%), Positives = 24/49 (48%) Frame = -1 Query: 499 HLTTTVQKTVHYNTTPHTTNIMKGGFHSHRCHYVGLARLPILSAWKLLR 353 H+T +Q+T T + N+ +G H Y + +P L +K+L+ Sbjct: 84 HITVEMQRTTCLKTEKNLCNVQEGELHKQIQCYFSVYVIPWLEVFKMLK 132
>FENR_CHLRE (P53991) Ferredoxin--NADP reductase, chloroplast precursor (EC| 1.18.1.2) (FNR) Length = 354 Score = 29.3 bits (64), Expect = 6.3 Identities = 13/45 (28%), Positives = 22/45 (48%) Frame = -1 Query: 337 CYRRPRMAARSQGQRVSTPIAXXXXXXXXXXFLSGILAPS*IDQG 203 C RR R+A R G+R+ P+A +S P+ +++G Sbjct: 15 CSRRLRVATRVAGRRMCRPVAATKASTAVTTDMSKRTVPTKLEEG 59 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 64,572,094 Number of Sequences: 219361 Number of extensions: 1214541 Number of successful extensions: 3311 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 3247 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3311 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3638905326 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)