| Clone Name | bags19f23 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | SC61A_YEAST (P32915) Protein transport protein SEC61 alpha subunit | 31 | 0.99 | 2 | PMT7_YEAST (Q06644) Dolichyl-phosphate-mannose--protein mannosyl... | 30 | 2.2 | 3 | PRTR_PSEAE (Q06553) HTH-type transcriptional regulator prtR (Pyo... | 29 | 4.9 | 4 | AAT_THEAQ (O33822) Aspartate aminotransferase (EC 2.6.1.1) (Tran... | 28 | 8.3 |
|---|
>SC61A_YEAST (P32915) Protein transport protein SEC61 alpha subunit| Length = 480 Score = 31.2 bits (69), Expect = 0.99 Identities = 16/41 (39%), Positives = 24/41 (58%) Frame = +1 Query: 160 LPSNSYLDLGGPYGKFVPFIIAGEGGFGEHKQLNWTNLFLL 282 + SN LDL P+ F+P +IA E +++L WT + LL Sbjct: 1 MSSNRVLDLFKPFESFLPEVIAPERKVPYNQKLIWTGVSLL 41
>PMT7_YEAST (Q06644) Dolichyl-phosphate-mannose--protein mannosyltransferase 7| (EC 2.4.1.109) Length = 662 Score = 30.0 bits (66), Expect = 2.2 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +1 Query: 178 LDLGGPYGKFVPFIIAGEGGFGEHKQLNWTNLFLL 282 L L GPY K++P+ I + G G K L++ FL+ Sbjct: 4 LRLQGPYRKYIPYNIFQQCGIGHLKTLDYIFAFLI 38
>PRTR_PSEAE (Q06553) HTH-type transcriptional regulator prtR (Pyocin repressor| protein) Length = 256 Score = 28.9 bits (63), Expect = 4.9 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = +1 Query: 109 YRLPQAGVRTSNFERRELPSNSY 177 YRLP G+R +F R E P Y Sbjct: 202 YRLPGGGIRLRSFNREEYPDEEY 224
>AAT_THEAQ (O33822) Aspartate aminotransferase (EC 2.6.1.1) (Transaminase A)| (ASPAT) Length = 383 Score = 28.1 bits (61), Expect = 8.3 Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 3/80 (3%) Frame = -3 Query: 357 FNIF-LYFDLIDHLIMIAAYVTA--KLVQ*KQVCPVELLMLPKAPFTSDYERHKFSIRPT 187 FN+F D D +I++A Y + ++V+ PVE+ LP+ F D ER + +I P Sbjct: 105 FNLFQAILDPGDEVIVLAPYWVSYPEMVRFAGGVPVEVPTLPEEGFVPDPERVRRAITP- 163 Query: 186 QIKVAV*WKLPTLEIGSPNS 127 + L + SPN+ Sbjct: 164 --------RTKALVVNSPNN 175 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,355,170 Number of Sequences: 219361 Number of extensions: 997470 Number of successful extensions: 1985 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1957 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1985 length of database: 80,573,946 effective HSP length: 100 effective length of database: 58,637,846 effective search space used: 2169600302 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)