ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags18p13 |
|---|---|
| Clone Library Name | barley_pub |
>AP1M_CAEEL (P35602) AP-1 complex subunit mu (Clathrin coat assembly protein| AP47) (Clathrin coat-associated protein AP47) (Golgi adaptor AP-1 47 kDa protein) (HA1 47 kDa subunit) (Clathrin assembly protein assembly protein complex 1 medium chain) (Uncoor Length = 422 Score = 68.9 bits (167), Expect = 4e-12 Identities = 34/45 (75%), Positives = 39/45 (86%) Frame = +2 Query: 5 SLPSITSEEATPEKKAPIRVKFEIPYFTVSGIQVRYLKVIEKSGY 139 SLPS+ SEE+ E + PI+VKFEIPYFT SGIQVRYLK+IEKSGY Sbjct: 360 SLPSVMSEES--EGRPPIKVKFEIPYFTTSGIQVRYLKIIEKSGY 402
>AP1M2_MOUSE (Q9WVP1) AP-1 complex subunit mu-2 (Adaptor-related protein complex| 1 mu-2 subunit) (Mu-adaptin 2) (Adaptor protein complex AP-1 mu-2 subunit) (Golgi adaptor HA1/AP1 adaptin mu-2 subunit) (Clathrin assembly protein assembly protein complex 1 Length = 423 Score = 67.4 bits (163), Expect = 1e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = +2 Query: 2 FSLPSITSEEATPEKKAPIRVKFEIPYFTVSGIQVRYLKVIEKSGY 139 F LPS+ +EE E + PI VKFEIPYFTVSGIQVRY+K+IEKSGY Sbjct: 360 FGLPSVETEEV--EGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGY 403
>AP1M2_HUMAN (Q9Y6Q5) AP-1 complex subunit mu-2 (Adaptor-related protein complex| 1 mu-2 subunit) (Mu-adaptin 2) (Adaptor protein complex AP-1 mu-2 subunit) (Golgi adaptor HA1/AP1 adaptin mu-2 subunit) (Clathrin assembly protein assembly protein complex 1 Length = 423 Score = 67.0 bits (162), Expect = 1e-11 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 2 FSLPSITSEEATPEKKAPIRVKFEIPYFTVSGIQVRYLKVIEKSGY 139 F LPS+ EE E + PI VKFEIPYFTVSGIQVRY+K+IEKSGY Sbjct: 360 FGLPSVEKEEV--EGRPPIGVKFEIPYFTVSGIQVRYMKIIEKSGY 403
>AP1M1_MOUSE (P35585) AP-1 complex subunit mu-1 (Adaptor-related protein complex| 1 mu-1 subunit) (Mu-adaptin 1) (Adaptor protein complex AP-1 mu-1 subunit) (Golgi adaptor HA1/AP1 adaptin mu-1 subunit) (Clathrin assembly protein assembly protein complex 1 Length = 422 Score = 66.6 bits (161), Expect = 2e-11 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 2 FSLPSITSEEATPEKKAPIRVKFEIPYFTVSGIQVRYLKVIEKSGY 139 F LPS+ +E+ E K PI VKFEIPYFT SGIQVRYLK+IEKSGY Sbjct: 359 FGLPSVEAEDK--EGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGY 402
>AP1M1_HUMAN (Q9BXS5) AP-1 complex subunit mu-1 (Adaptor-related protein complex| 1 mu-1 subunit) (Mu-adaptin 1) (Adaptor protein complex AP-1 mu-1 subunit) (Golgi adaptor HA1/AP1 adaptin mu-1 subunit) (Clathrin assembly protein assembly protein complex 1 Length = 422 Score = 66.6 bits (161), Expect = 2e-11 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = +2 Query: 2 FSLPSITSEEATPEKKAPIRVKFEIPYFTVSGIQVRYLKVIEKSGY 139 F LPS+ +E+ E K PI VKFEIPYFT SGIQVRYLK+IEKSGY Sbjct: 359 FGLPSVEAEDK--EGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGY 402
>AP1M1_SCHPO (Q9HFE5) AP-1 complex subunit mu-1 (Mu(1)-adaptin) (Clathrin| assembly protein complex 1 medium chain) Length = 426 Score = 56.2 bits (134), Expect = 2e-08 Identities = 24/40 (60%), Positives = 32/40 (80%) Frame = +2 Query: 8 LPSITSEEATPEKKAPIRVKFEIPYFTVSGIQVRYLKVIE 127 LPS+ +E+ +KK P+++KF IPYFT SGIQVRYLK+ E Sbjct: 362 LPSVKNEDIQVQKKRPVQLKFAIPYFTTSGIQVRYLKITE 401
>AP1M1_YEAST (Q00776) AP-1 complex subunit mu-1 (Mu(1)-adaptin) (Clathrin| assembly protein complex 1 medium chain) (Clathrin coat assembly protein AP54) (Clathrin coat-associated protein AP54) (Golgi adaptor AP-1 54 kDa protein) (HA1 54 kDa subunit) Length = 475 Score = 47.8 bits (112), Expect = 9e-06 Identities = 25/49 (51%), Positives = 33/49 (67%), Gaps = 9/49 (18%) Frame = +2 Query: 8 LPSITSEE----ATPEK-----KAPIRVKFEIPYFTVSGIQVRYLKVIE 127 LPSI++ E P+ K P+++KF+IPYFT SGIQVRYLK+ E Sbjct: 401 LPSISNNEDGNRTMPKSNAEILKGPVQIKFQIPYFTTSGIQVRYLKINE 449
>AP2M_DICDI (P54672) AP-2 complex subunit mu (Clathrin coat assembly protein| AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (Clathrin assembly protein complex 2 medium chain) Length = 439 Score = 40.0 bits (92), Expect = 0.002 Identities = 16/31 (51%), Positives = 23/31 (74%) Frame = +2 Query: 47 KAPIRVKFEIPYFTVSGIQVRYLKVIEKSGY 139 + PI ++F++ FT SG VR+LKV+EKS Y Sbjct: 390 RPPISMEFQVTMFTASGFSVRFLKVVEKSNY 420
>APM2_YEAST (P38700) Adaptin medium chain homolog APM2| Length = 605 Score = 35.0 bits (79), Expect = 0.057 Identities = 17/35 (48%), Positives = 22/35 (62%) Frame = +2 Query: 23 SEEATPEKKAPIRVKFEIPYFTVSGIQVRYLKVIE 127 + TP K + + FEIPY T SG++V YLKV E Sbjct: 547 TSHVTPRDKL-VNIDFEIPYCTCSGLKVEYLKVEE 580
>AP2M1_RAT (P84092) AP-2 complex subunit mu-1 (Adaptin mu-1) (AP-2 mu-2 chain)| (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (Clathrin assembly protein complex 2 medium chain) Length = 435 Score = 32.3 bits (72), Expect = 0.37 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +2 Query: 47 KAPIRVKFEIPYFTVSGIQVRYLKVIE 127 + PI + FE+P F SG++VRYLKV E Sbjct: 383 RPPISMNFEVP-FAPSGLKVRYLKVFE 408
>AP2M1_MOUSE (P84091) AP-2 complex subunit mu-1 (Adaptin mu-1) (AP-2 mu-2 chain)| (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (Clathrin assembly protein complex 2 medium chain) Length = 435 Score = 32.3 bits (72), Expect = 0.37 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +2 Query: 47 KAPIRVKFEIPYFTVSGIQVRYLKVIE 127 + PI + FE+P F SG++VRYLKV E Sbjct: 383 RPPISMNFEVP-FAPSGLKVRYLKVFE 408
>AP2M1_HUMAN (Q96CW1) AP-2 complex subunit mu-1 (Adaptin mu-1) (AP-2 mu-2 chain)| (Clathrin coat assembly protein AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (HA2 50 kDa subunit) (Clathrin assembly protein co Length = 435 Score = 32.3 bits (72), Expect = 0.37 Identities = 15/27 (55%), Positives = 20/27 (74%) Frame = +2 Query: 47 KAPIRVKFEIPYFTVSGIQVRYLKVIE 127 + PI + FE+P F SG++VRYLKV E Sbjct: 383 RPPISMNFEVP-FAPSGLKVRYLKVFE 408
>AP4M1_HUMAN (O00189) AP-4 complex subunit mu-1 (Adapter-related protein complex| 4 mu-1 subunit) (Mu subunit of AP-4) (AP-4 adapter complex mu subunit) (Mu-adaptin-related protein 2) (mu-ARP2) (mu4) Length = 453 Score = 32.0 bits (71), Expect = 0.48 Identities = 14/33 (42%), Positives = 21/33 (63%) Frame = +2 Query: 23 SEEATPEKKAPIRVKFEIPYFTVSGIQVRYLKV 121 S A+P P + FE+P T SG+QVR+L++ Sbjct: 394 STSASPLGLGPASLSFELPRHTCSGLQVRFLRL 426
>AP2M_CAEEL (P35603) AP-2 complex subunit mu (Clathrin coat assembly protein| AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (Clathrin assembly protein complex 2 medium chain) (Dumpy protein 23) Length = 441 Score = 32.0 bits (71), Expect = 0.48 Identities = 14/27 (51%), Positives = 20/27 (74%) Frame = +2 Query: 47 KAPIRVKFEIPYFTVSGIQVRYLKVIE 127 + P+ + FE+P F SG++VRYLKV E Sbjct: 389 RPPVSMNFEVP-FAPSGLKVRYLKVFE 414
>AP4M1_RAT (Q2PWT8) AP-4 complex subunit mu-1 (Adapter-related protein complex| 4 mu-1 subunit) (Mu subunit of AP-4) (AP-4 adapter complex mu subunit) (Mu-adaptin-related protein 2) (mu-ARP2) (mu4) Length = 453 Score = 31.2 bits (69), Expect = 0.83 Identities = 14/33 (42%), Positives = 20/33 (60%) Frame = +2 Query: 23 SEEATPEKKAPIRVKFEIPYFTVSGIQVRYLKV 121 S A P P + FE+P T SG+QVR+L++ Sbjct: 394 SPSAPPLGLGPASLSFELPRHTCSGLQVRFLRL 426
>AP2M_SCHPO (Q09718) AP-2 complex subunit mu (Probable clathrin coat assembly| protein AP50) (Clathrin coat-associated protein AP50) (Plasma membrane adaptor AP-2 50 kDa protein) (Clathrin assembly protein complex 2 medium chain) Length = 446 Score = 31.2 bits (69), Expect = 0.83 Identities = 15/29 (51%), Positives = 19/29 (65%) Frame = +2 Query: 47 KAPIRVKFEIPYFTVSGIQVRYLKVIEKS 133 K PI + F I FT SG+ V+YL+V E S Sbjct: 395 KPPISLDFNILMFTSSGLHVQYLRVSEPS 423
>AP4M1_MOUSE (Q9JKC7) AP-4 complex subunit mu-1 (Adapter-related protein complex| 4 mu-1 subunit) (Mu subunit of AP-4) (AP-4 adapter complex mu subunit) (Mu-adaptin-related protein 2) (mu-ARP2) (mu4) Length = 449 Score = 30.0 bits (66), Expect = 1.8 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +2 Query: 8 LPSITSEEATPEKKAPIRVKFEIPYFTVSGIQVRYLKV 121 L + + +P P + FE+P T SG+QVR+L++ Sbjct: 385 LQGLPNHGPSPLGLGPASLSFELPRHTCSGLQVRFLRL 422
>AP1M_DISOM (P47795) AP-1 complex subunit mu (Clathrin coat assembly protein| AP47 homolog) (Clathrin coat-associated protein AP47 homolog) (Golgi adaptor AP-1 47 kDa protein homolog) (HA1 47 kDa subunit homolog) (Clathrin assembly protein assembly protein Length = 418 Score = 28.1 bits (61), Expect = 7.0 Identities = 13/36 (36%), Positives = 21/36 (58%) Frame = +2 Query: 8 LPSITSEEATPEKKAPIRVKFEIPYFTVSGIQVRYL 115 L ++ S EA PE+ + ++F I VSG++V L Sbjct: 357 LINLQSGEAKPEENPTLNIQFRIQQLAVSGLKVNRL 392 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,363,265 Number of Sequences: 219361 Number of extensions: 247128 Number of successful extensions: 486 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 484 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 486 length of database: 80,573,946 effective HSP length: 22 effective length of database: 75,748,004 effective search space used: 1817952096 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
