ナショナルバイオリソースプロジェクト
-Barley Genetic Resources Database-
menu 
| Clone Name | bags18j12 |
|---|---|
| Clone Library Name | barley_pub |
>TPX2_ARATH (O22711) Peroxiredoxin TPx2 (EC 1.11.1.15) (Thioredoxin reductase)| Length = 162 Score = 75.9 bits (185), Expect = 3e-14 Identities = 34/44 (77%), Positives = 37/44 (84%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGLELDLTEKGL 133 NDPFVMKAW KTY ENKHVKF+ADG+ YT LGLELDL +KGL Sbjct: 80 NDPFVMKAWGKTYQENKHVKFVADGSGEYTHLLGLELDLKDKGL 123
>MALF2_MALFU (P56577) Putative peroxiredoxin (EC 1.11.1.15) (Thioredoxin| reductase) (Allergen Mal f 2) (MF1) Length = 177 Score = 38.1 bits (87), Expect = 0.007 Identities = 19/42 (45%), Positives = 23/42 (54%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGLELDLTEK 127 NDPFVM AW V F D A++KALG +DL+ K Sbjct: 93 NDPFVMAAWGNFNNAKDKVVFATDIDLAFSKALGATIDLSAK 134
>AHP1_YEAST (P38013) Peroxiredoxin type-2 (EC 1.11.1.15) (Peroxiredoxin type| II) (Peroxisomal alkyl hydroperoxide reductase) (Thioredoxin peroxidase type II) (Thioredoxin reductase type II) (TPx type II) (Cytoplasmic thiol peroxidase 3) (cTPx 3) (Thiol-sp Length = 175 Score = 37.7 bits (86), Expect = 0.009 Identities = 16/39 (41%), Positives = 26/39 (66%), Gaps = 2/39 (5%) Frame = +2 Query: 2 NDPFVMKAWAKTY--PENKHVKFLADGAAAYTKALGLEL 112 ++PF +AWAK+ + H+KF +D A+TK++G EL Sbjct: 91 DNPFANQAWAKSLGVKDTTHIKFASDPGCAFTKSIGFEL 129
>PMPB_CANBO (P14293) Putative peroxiredoxin-B (EC 1.11.1.15) (Thioredoxin| reductase) (Peroxisomal membrane protein B) (PMP20) (Allergen Cand b 2) Length = 166 Score = 35.4 bits (80), Expect = 0.044 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +2 Query: 2 NDPFVMKAWAKTY--PENKHVKFLADGAAAYTKALGLELDLTEKGL 133 NDPFV+K W K + K + F++D TK LG +DL+ GL Sbjct: 81 NDPFVLKGWKKELGAADAKKLIFVSDPNLKLTKKLGSTIDLSSIGL 126
>PMPA_CANBO (P14292) Putative peroxiredoxin-A (EC 1.11.1.15) (Thioredoxin| reductase) (Peroxisomal membrane protein A) (PMP20) (Allergen Cand b 2) Length = 166 Score = 35.4 bits (80), Expect = 0.044 Identities = 19/46 (41%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +2 Query: 2 NDPFVMKAWAKTY--PENKHVKFLADGAAAYTKALGLELDLTEKGL 133 NDPFV+K W K + K + F++D TK LG +DL+ GL Sbjct: 81 NDPFVLKGWKKELGAADAKKLVFVSDPNLKLTKKLGSTIDLSAIGL 126
>MALF3_MALFU (P56578) Putative peroxiredoxin (EC 1.11.1.15) (Thioredoxin| reductase) (Allergen Mal f 3) (MF2) (Fragment) Length = 166 Score = 35.4 bits (80), Expect = 0.044 Identities = 16/44 (36%), Positives = 23/44 (52%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGLELDLTEKGL 133 NDPFV+ AW T ++ F D ++K LDL+ KG+ Sbjct: 85 NDPFVLSAWGITEHAKDNLTFAQDVNCEFSKHFNATLDLSSKGM 128
>YRP2_RHIET (O69777) Putative peroxiredoxin in rpoN2 3' region (EC 1.11.1.15)| (Thioredoxin reductase) Length = 179 Score = 33.9 bits (76), Expect = 0.13 Identities = 15/35 (42%), Positives = 23/35 (65%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGL 106 ND FVM AW K+ K+VK + DG+ +T+ +G+ Sbjct: 85 NDAFVMNAWGKS-QGLKNVKLIPDGSGEFTRKMGM 118
>PDX_ARATH (Q9M7T0) Putative peroxiredoxin, mitochondrial precursor (EC| 1.11.1.15) (Thioredoxin reductase) Length = 201 Score = 33.5 bits (75), Expect = 0.17 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGLELDLT 121 NDPF + WA+ ++F D + K+LGL+ DL+ Sbjct: 118 NDPFAINGWAEKLGAKDAIEFYGDFDGKFHKSLGLDKDLS 157
>PRDX5_MOUSE (P99029) Peroxiredoxin-5, mitochondrial precursor (EC 1.11.1.15)| (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin reductase) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (Liver tissue 2D-page spot 2D-0014IV) Length = 210 Score = 32.3 bits (72), Expect = 0.37 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGLELD 115 ND FV++ W + + V+ LAD A+ KA L LD Sbjct: 125 NDVFVIEEWGRAHQAEGKVRLLADPTGAFGKATDLLLD 162
>PRX5_HAEIN (P44758) Hybrid peroxiredoxin hyPrx5 (EC 1.11.1.15) (Thioredoxin| reductase) Length = 241 Score = 32.0 bits (71), Expect = 0.49 Identities = 13/35 (37%), Positives = 23/35 (65%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGL 106 ND FVM AW K +++++ F+ DG +T+ +G+ Sbjct: 78 NDTFVMNAW-KEDEKSENISFIPDGNGEFTEGMGM 111
>PRDX5_BOVIN (Q9BGI1) Peroxiredoxin-5, mitochondrial precursor (EC 1.11.1.15)| (Prx-V) (Thioredoxin reductase) Length = 219 Score = 32.0 bits (71), Expect = 0.49 Identities = 15/38 (39%), Positives = 21/38 (55%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGLELD 115 ND FV + WA+T+ V+ LAD + + K L LD Sbjct: 134 NDVFVTEEWARTHKAEGKVRLLADPSGTFGKETDLLLD 171
>Y4VD_RHISN (Q53212) Putative peroxiredoxin y4vD (EC 1.11.1.15) (Thioredoxin| reductase) Length = 188 Score = 32.0 bits (71), Expect = 0.49 Identities = 14/35 (40%), Positives = 21/35 (60%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGL 106 ND FVM AW K K V+ + DG+ +T+ +G+ Sbjct: 85 NDAFVMNAWGKALGLEK-VRLIPDGSGEFTRKMGM 118
>PALF_ASHGO (Q754G2) pH-response regulator protein palF/RIM8| Length = 548 Score = 30.0 bits (66), Expect = 1.9 Identities = 11/34 (32%), Positives = 21/34 (61%) Frame = -3 Query: 122 P*DQAQDQVLLCMLPLHQQGTSHACSLGMSLPMP 21 P + + + C+ PL+ + +H CS+GM+L +P Sbjct: 290 PMETFRKDICQCVAPLYVEPETHTCSVGMNLNVP 323
>PRDX5_RAT (Q9R063) Peroxiredoxin-5, mitochondrial precursor (EC 1.11.1.15)| (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin reductase) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) Length = 213 Score = 28.9 bits (63), Expect = 4.1 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGLELD 115 ND FV W + + V+ LAD A+ K L LD Sbjct: 128 NDAFVTAEWGRAHQAEGKVQLLADPTGAFGKETDLLLD 165
>PRDX5_HUMAN (P30044) Peroxiredoxin-5, mitochondrial precursor (EC 1.11.1.15)| (Prx-V) (Peroxisomal antioxidant enzyme) (PLP) (Thioredoxin reductase) (Thioredoxin peroxidase PMP20) (Antioxidant enzyme B166) (AOEB166) (TPx type VI) (Liver tissue 2D-page spo Length = 214 Score = 28.9 bits (63), Expect = 4.1 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGLELD 115 ND FV W + + V+ LAD A+ K L LD Sbjct: 129 NDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLD 166
>PRDX5_CERAE (Q9GLW7) Peroxiredoxin-5, mitochondrial precursor (EC 1.11.1.15)| (Prx-V) (Thioredoxin reductase) Length = 215 Score = 28.9 bits (63), Expect = 4.1 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGLELD 115 ND FV W + + V+ LAD A+ K L LD Sbjct: 130 NDAFVTGEWGRAHKAEGKVRLLADPTGAFGKETDLLLD 167
>PRDX5_PAPHA (Q9GLW9) Peroxiredoxin-5, mitochondrial precursor (EC 1.11.1.15)| (Prx-V) (Thioredoxin reductase) Length = 215 Score = 28.5 bits (62), Expect = 5.4 Identities = 14/38 (36%), Positives = 18/38 (47%) Frame = +2 Query: 2 NDPFVMKAWAKTYPENKHVKFLADGAAAYTKALGLELD 115 ND FV W + + V+ LAD A+ K L LD Sbjct: 130 NDAFVTGEWGRAHKVEGKVRLLADPTGAFGKETDLLLD 167
>PMP20_ASPFU (O43099) Putative peroxiredoxin pmp20 (EC 1.11.1.15) (Thioredoxin| reductase) (Peroxisomal membrane protein pmp20) (Allergen Asp f 3) Length = 168 Score = 27.7 bits (60), Expect = 9.2 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 1/35 (2%) Frame = +2 Query: 2 NDPFVMKAWAK-TYPENKHVKFLADGAAAYTKALG 103 ND +VM AW K + FL+D A ++K++G Sbjct: 90 NDAYVMSAWGKANQVTGDDILFLSDPDARFSKSIG 124 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 20,558,353 Number of Sequences: 219361 Number of extensions: 277760 Number of successful extensions: 971 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 965 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 970 length of database: 80,573,946 effective HSP length: 19 effective length of database: 76,406,087 effective search space used: 1833746088 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)
