| Clone Name | bags18d02 |
|---|---|
| Clone Library Name | barley_pub |
>SPKB_SYNY3 (P74297) Serine/threonine-protein kinase B (EC 2.7.11.1)| Length = 574 Score = 44.3 bits (103), Expect = 1e-04 Identities = 24/57 (42%), Positives = 30/57 (52%) Frame = +3 Query: 282 AQFGXADLKNTVHVNENFRRANFTSADMRESDFSGSTFNGAYMEKAVAFRANFTGAD 452 A FG A LKN + N A F AD+R +D G+ NG + A ANF+GAD Sbjct: 489 ADFGKARLKNVIFKGANLSDAYFGYADLRGADLRGANLNGVNFKYANLQGANFSGAD 545 Score = 28.9 bits (63), Expect = 6.3 Identities = 15/43 (34%), Positives = 22/43 (51%) Frame = +3 Query: 276 SAAQFGXADLKNTVHVNENFRRANFTSADMRESDFSGSTFNGA 404 S A FG ADL+ N NF A+++ ++FSG+ A Sbjct: 507 SDAYFGYADLRGADLRGANLNGVNFKYANLQGANFSGADLGSA 549 Score = 28.5 bits (62), Expect = 8.2 Identities = 15/43 (34%), Positives = 20/43 (46%) Frame = +3 Query: 324 NENFRRANFTSADMRESDFSGSTFNGAYMEKAVAFRANFTGAD 452 N NF +A T AD ++ F GA + A A+ GAD Sbjct: 478 NANFEQAELTRADFGKARLKNVIFKGANLSDAYFGYADLRGAD 520
>YMO3_ERWST (Q52118) Hypothetical 31.4 kDa protein in mobD 3'region| Length = 295 Score = 35.0 bits (79), Expect = 0.088 Identities = 19/57 (33%), Positives = 27/57 (47%) Frame = +3 Query: 282 AQFGXADLKNTVHVNENFRRANFTSADMRESDFSGSTFNGAYMEKAVAFRANFTGAD 452 A DL N N AN T A + E+D S + + A +++A AN +GAD Sbjct: 137 ANLNQTDLPNVNLSGANLAHANLTMAYLSEADLSNANLSNADLKRADLSNANLSGAD 193
>Y516_SYNY3 (Q55837) Hypothetical protein slr0516| Length = 166 Score = 33.9 bits (76), Expect = 0.20 Identities = 15/41 (36%), Positives = 24/41 (58%) Frame = +3 Query: 330 NFRRANFTSADMRESDFSGSTFNGAYMEKAVAFRANFTGAD 452 + R N +A + SD SG+ +G + +A+ RAN TGA+ Sbjct: 49 DLREFNLENARLNRSDLSGANLSGVNLRRALLDRANLTGAN 89
>Y1851_SYNY3 (P73063) Hypothetical protein slr1851| Length = 162 Score = 32.7 bits (73), Expect = 0.44 Identities = 16/43 (37%), Positives = 22/43 (51%) Frame = +3 Query: 324 NENFRRANFTSADMRESDFSGSTFNGAYMEKAVAFRANFTGAD 452 N + AN AD+ +D SG+ GA + KA A+ GAD Sbjct: 82 NADLSGANLVGADLTNADLSGAKLGGADLRKANLSEASLRGAD 124 Score = 28.9 bits (63), Expect = 6.3 Identities = 19/57 (33%), Positives = 23/57 (40%) Frame = +3 Query: 282 AQFGXADLKNTVHVNENFRRANFTSADMRESDFSGSTFNGAYMEKAVAFRANFTGAD 452 AQ A LKN N AD+ +D SG+ GA + A A GAD Sbjct: 53 AQLDSATLKNANLALANMTEVCLIYADLSNADLSGANLVGADLTNADLSGAKLGGAD 109
>MCBG_ECOLI (P05530) Protein mcbG| Length = 187 Score = 31.2 bits (69), Expect = 1.3 Identities = 13/32 (40%), Positives = 21/32 (65%) Frame = +3 Query: 303 LKNTVHVNENFRRANFTSADMRESDFSGSTFN 398 L+ ++ ++ FR F D+R+SDF+GS FN Sbjct: 104 LQKSIFLSCRFRDCLFEETDLRKSDFTGSEFN 135
>TL15_ARATH (O22160) Thylakoid lumenal 15 kDa protein, chloroplast precursor| (p15) Length = 224 Score = 30.8 bits (68), Expect = 1.7 Identities = 17/51 (33%), Positives = 26/51 (50%) Frame = +3 Query: 297 ADLKNTVHVNENFRRANFTSADMRESDFSGSTFNGAYMEKAVAFRANFTGA 449 A+ K + +F A+ T AD+ E+D G+ F+ A + K AN GA Sbjct: 121 ANFKGAKLLGASFFDADLTGADLSEADLRGADFSLANVTKVNLTNANLEGA 171
>Y1819_SYNY3 (P73709) Hypothetical protein slr1819| Length = 331 Score = 30.0 bits (66), Expect = 2.8 Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 10/78 (12%) Frame = +3 Query: 249 DQRGEFGIGSAAQFGXADLKNT----VHVNE------NFRRANFTSADMRESDFSGSTFN 398 +++G + AA G ADL+ V ++ N + AN D+R++D S + Sbjct: 140 EKKGYYTNLQAAILGRADLQGANMKGVDLSRADLSYANLKEANLRDVDLRKADLSYANLK 199 Query: 399 GAYMEKAVAFRANFTGAD 452 GA + A A GAD Sbjct: 200 GALLTDANLSGAKLNGAD 217 Score = 29.3 bits (64), Expect = 4.8 Identities = 15/37 (40%), Positives = 21/37 (56%) Frame = +3 Query: 282 AQFGXADLKNTVHVNENFRRANFTSADMRESDFSGST 392 A F A+L +N N RA+ SA+M +DF G+T Sbjct: 286 AFFARANLTEANFINANLVRADLMSANMVGADFQGAT 322
>OMPB_RICPR (Q53020) Outer membrane protein B precursor (168 kDa surface-layer| protein) (Surface protein antigen) (Cell surface antigen 5) (Sca5) (rOmpB) (rOmp B) [Contains: 120 kDa surface-exposed protein (Surface protein antigen) (120 kDa outer membrane Length = 1643 Score = 30.0 bits (66), Expect = 2.8 Identities = 18/68 (26%), Positives = 26/68 (38%), Gaps = 9/68 (13%) Frame = +3 Query: 261 EFGIGSAAQFGXADLKNTVHVNENFRRANFTSADMR---------ESDFSGSTFNGAYME 413 + G+G F AD K + N NF NF + D + + +F G N Sbjct: 372 DVGLGGTTNFKTADSKVIITENSNFGSTNFGNLDTQIVVPDTKILKGNFIGDVKNNGNTA 431 Query: 414 KAVAFRAN 437 + F AN Sbjct: 432 GVITFNAN 439
>NCKX_DROME (Q9U6A0) Sodium/potassium/calcium exchanger| (Na(+)/K(+)/Ca(2+)-exchange protein) Length = 856 Score = 29.3 bits (64), Expect = 4.8 Identities = 19/56 (33%), Positives = 29/56 (51%), Gaps = 6/56 (10%) Frame = +3 Query: 6 ASTSPLAATVARPKAPASLTRCRSRRLQRISCQA------TTDRSGGGNASNTSPA 155 ++TS A+ + P+S +RCRSRR R+ + TT G G+A+ PA Sbjct: 166 SATSSRGASAEQLLHPSSRSRCRSRRCLRLPIYSILLLCLTTQGLGLGDAAKPRPA 221
>TCF8_CHICK (P36197) Transcription factor 8 (Delta-crystallin enhancer-binding| factor) (Delta EF1) Length = 1114 Score = 29.3 bits (64), Expect = 4.8 Identities = 29/113 (25%), Positives = 39/113 (34%), Gaps = 2/113 (1%) Frame = +2 Query: 5 RFHLPSCRHRCSA*GSRFPHALSFTPXXAHLLPGDHRPLRRRQCVEYVAGAAEVARSGLC 184 R H ++C G RF H+ S++ H R R E EV S Sbjct: 952 RLHSGEKPYQCDKCGKRFSHSGSYSQHMNHRYSYCKREAEERDSTEQEEVGQEVLSSEHA 1011 Query: 185 SPRGCRSRSDACPRRS--EQVRGGSEGRVRHRFSRAVRXCGPQKHCAC*RKLQ 337 R S+ D+ R S + SE + V +K C RKLQ Sbjct: 1012 GARASPSQIDSDERESLTREEEEDSEKEEEEEEEKDVEGLQEEKEC---RKLQ 1061 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,416,553 Number of Sequences: 219361 Number of extensions: 956009 Number of successful extensions: 2564 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 2460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2558 length of database: 80,573,946 effective HSP length: 102 effective length of database: 58,199,124 effective search space used: 2793557952 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)