| Clone Name | bags18c13 |
|---|---|
| Clone Library Name | barley_pub |
| No. | Definition | Score (bits) |
E Value |
1 | FTSK_HELPJ (Q9ZM87) DNA translocase ftsK | 33 | 0.54 | 2 | MBX1_SCHPO (O42954) MADS-box transcription factor 1 | 32 | 0.92 | 3 | Y1375_HAEIN (P44169) Hypothetical protein HI1375 | 31 | 1.6 |
|---|
>FTSK_HELPJ (Q9ZM87) DNA translocase ftsK| Length = 844 Score = 32.7 bits (73), Expect = 0.54 Identities = 11/31 (35%), Positives = 21/31 (67%) Frame = -2 Query: 452 LPINPTTTHSHDRKYSHKTPDVPLVSSEISE 360 +PI+ + T +HD+ +HKTP+ P+ ++ E Sbjct: 288 MPISASNTENHDKTENHKTPNHPIKEDDLQE 318
>MBX1_SCHPO (O42954) MADS-box transcription factor 1| Length = 436 Score = 32.0 bits (71), Expect = 0.92 Identities = 32/106 (30%), Positives = 45/106 (42%), Gaps = 6/106 (5%) Frame = -2 Query: 452 LPINPTTTHSHDRKYSHKTPDVPLVSSEISEFYAIYEPEVAREEIRGSLADFKRHE*LRS 273 LP++PT HS S D PL S S F V E + +L+ F+ ++ ++ Sbjct: 159 LPLSPTVKHSFVSPVSGDYSDSPLEPSSSSSF------SVPPESLNPTLS-FQHNDVPQT 211 Query: 272 KTLQPFL-PHRTTCLQM-----LIFVRRQHSIKNSRSANNELNILH 153 PFL P R Q VRR S KN R+ ++ LH Sbjct: 212 DNFIPFLTPKRQAYGQSSSRADRSSVRRSQSFKNRRNGKPRISRLH 257
>Y1375_HAEIN (P44169) Hypothetical protein HI1375| Length = 302 Score = 31.2 bits (69), Expect = 1.6 Identities = 16/45 (35%), Positives = 23/45 (51%) Frame = -2 Query: 317 RGSLADFKRHE*LRSKTLQPFLPHRTTCLQMLIFVRRQHSIKNSR 183 +G L+ K+ + K +Q T L IF+R + SIKNSR Sbjct: 8 KGQLSQLKQQKFKLEKDIQRLFEENLTLLSGYIFIRSEFSIKNSR 52 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 59,379,315 Number of Sequences: 219361 Number of extensions: 1034837 Number of successful extensions: 2879 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 2774 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2879 length of database: 80,573,946 effective HSP length: 104 effective length of database: 57,760,402 effective search space used: 3465624120 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)