| Clone Name | bags17m04 |
|---|---|
| Clone Library Name | barley_pub |
>TAU_HUMAN (P10636) Microtubule-associated protein tau (Neurofibrillary tangle| protein) (Paired helical filament-tau) (PHF-tau) Length = 757 Score = 30.8 bits (68), Expect = 2.7 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +3 Query: 273 EHVDQPYLDERRPGCARVAVPRTILPENLTEPTTGIKFPTLLEENS 410 E V P +DE PG A P T +PE T GI LE+ + Sbjct: 72 EDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEA 117
>TAU_MOUSE (P10637) Microtubule-associated protein tau (Neurofibrillary tangle| protein) (Paired helical filament-tau) (PHF-tau) Length = 732 Score = 30.8 bits (68), Expect = 2.7 Identities = 15/36 (41%), Positives = 18/36 (50%) Frame = +3 Query: 273 EHVDQPYLDERRPGCARVAVPRTILPENLTEPTTGI 380 E V P +DER P A P T +PE +T GI Sbjct: 61 EDVTAPLVDERAPDKQAAAQPHTEIPEGITAEEAGI 96
>TAU_MACMU (P57786) Microtubule-associated protein tau (Neurofibrillary tangle| protein) (Paired helical filament-tau) (PHF-tau) Length = 458 Score = 30.8 bits (68), Expect = 2.7 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +3 Query: 273 EHVDQPYLDERRPGCARVAVPRTILPENLTEPTTGIKFPTLLEENS 410 E V P +DER PG A P +PE T GI LE+ + Sbjct: 72 EDVTAPLVDERAPGEQAAAQPHMEIPEGTTAEEAGIGDTPSLEDEA 117
>Y1544_PARUW (Q6MAY1) Hypothetical RNA methyltransferase pc1544 (EC 2.1.1.-)| Length = 442 Score = 30.8 bits (68), Expect = 2.7 Identities = 27/103 (26%), Positives = 44/103 (42%), Gaps = 5/103 (4%) Frame = +3 Query: 177 LAAASVIPPFENISPKMLADSMMLGKDGGQIREHVDQPYLDERRPGCARVAVPRTILPEN 356 L+ SV+ EN+ L++ + D GQ+ E + Q + +P V PR L Sbjct: 324 LSRESVLDARENVKENGLSNVTIKSGDVGQVLEALSQE--NSLKPDVVMVDPPRIGLDAK 381 Query: 357 LTEPTTGIKFPTLLEENSNPTAEV-----LVGMGYRSMRVMKV 470 + +K P L+ + NP +V L+ GY+ V V Sbjct: 382 AIKHILDLKAPKLVYISCNPKTQVMNLGPLIDGGYQLQIVQPV 424
>TAU_PANTR (Q5YCW1) Microtubule-associated protein tau| Length = 775 Score = 30.8 bits (68), Expect = 2.7 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +3 Query: 273 EHVDQPYLDERRPGCARVAVPRTILPENLTEPTTGIKFPTLLEENS 410 E V P +DE PG A P T +PE T GI LE+ + Sbjct: 72 EDVTAPLVDEGAPGKQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEA 117
>UBR2_MOUSE (Q6WKZ8) Ubiquitin-protein ligase E3 component N-recognin-2 (EC| 6.-.-.-) (Ubiquitin-protein ligase E3-alpha-2) (Ubiquitin-protein ligase E3-alpha-II) Length = 1755 Score = 30.4 bits (67), Expect = 3.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 148 STSFHTRPSAAFASLAKSICTACSSLTCNPAKCCMQEV 35 +++F S S A ++C C SL C+ + CC E+ Sbjct: 1614 ASNFSCPKSGGDKSRAPTLCLVCGSLLCSQSYCCQAEL 1651
>UBR2_HUMAN (Q8IWV8) Ubiquitin-protein ligase E3 component N-recognin-2 (EC| 6.-.-.-) (Ubiquitin-protein ligase E3-alpha-2) (Ubiquitin-protein ligase E3-alpha-II) Length = 1755 Score = 30.4 bits (67), Expect = 3.5 Identities = 12/38 (31%), Positives = 20/38 (52%) Frame = -3 Query: 148 STSFHTRPSAAFASLAKSICTACSSLTCNPAKCCMQEV 35 +++F S S A ++C C SL C+ + CC E+ Sbjct: 1614 ASNFSCPKSGGDKSRAPTLCLVCGSLLCSQSYCCQTEL 1651
>TAU_GORGO (Q5YCW0) Microtubule-associated protein tau| Length = 775 Score = 30.4 bits (67), Expect = 3.5 Identities = 17/46 (36%), Positives = 21/46 (45%) Frame = +3 Query: 273 EHVDQPYLDERRPGCARVAVPRTILPENLTEPTTGIKFPTLLEENS 410 E V P +DE PG A P T +PE T GI LE+ + Sbjct: 72 EDVTAPLVDEGAPGEQAAAQPHTEIPEGTTAEEAGIGDTPSLEDEA 117
>TAU_SPECI (Q6TS35) Microtubule-associated protein tau| Length = 429 Score = 29.6 bits (65), Expect = 5.9 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +3 Query: 273 EHVDQPYLDERRPGCARVAVPRTILPENLTEPTTGI 380 E V P +DER PG P T +PE T GI Sbjct: 59 EDVTAPLVDERTPGEQAATQPPTDIPEGTTAEEAGI 94
>PIP_MOUSE (P02816) Prolactin-inducible protein homolog precursor (14 kDa| submandibular gland protein) (SMGP) (Gross cystic disease fluid protein 15) (GCDFP-15) Length = 146 Score = 29.3 bits (64), Expect = 7.8 Identities = 21/75 (28%), Positives = 34/75 (45%), Gaps = 4/75 (5%) Frame = +3 Query: 315 CARVAVPRTILPENLTEPTT-GIKFPTLLEENSNPTAEVLVGMGYRSMRVMK---VKNLN 482 C ++ + + EN+ +P I P+ +EN T +V V YR V+K V N Sbjct: 18 CLQLGIIESQDDENVRKPLLIEIDVPSTAQENQEITVQVTVETQYRECMVIKAYLVSNEP 77 Query: 483 LYAFGLYIQPDSICN 527 + Y+Q +CN Sbjct: 78 MEGAFNYVQTRCLCN 92 Database: uniprot_sprot.fasta Posted date: May 25, 2006 5:36 PM Number of letters in database: 80,573,946 Number of sequences in database: 219,361 Lambda K H 0.318 0.135 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 85,279,626 Number of Sequences: 219361 Number of extensions: 1810691 Number of successful extensions: 4990 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 4769 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4986 length of database: 80,573,946 effective HSP length: 105 effective length of database: 57,541,041 effective search space used: 4488201198 frameshift window, decay const: 50, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits)